Comparing AO356_02260 FitnessBrowser__pseudo5_N2C3_1:AO356_02260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 35% coverage: 75:224/432 of query aligns to 92:226/582 of O23492
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 69% coverage: 70:366/432 of query aligns to 70:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 69% coverage: 70:366/432 of query aligns to 70:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 69% coverage: 70:366/432 of query aligns to 70:407/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 69% coverage: 70:366/432 of query aligns to 74:411/491 of P0AGF4
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 72% coverage: 71:379/432 of query aligns to 63:392/446 of A0A0H2VG78
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
24% identity, 70% coverage: 65:366/432 of query aligns to 50:385/437 of 6rw3A
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 50% coverage: 7:222/432 of query aligns to 37:234/444 of Q8NLB7
Sites not aligning to the query:
>AO356_02260 FitnessBrowser__pseudo5_N2C3_1:AO356_02260
MSSTTSNGKAIFRVVSGNFLEMFDFMVYGFYATAIAKTFFPADSAFVSLMLSLATFGAGF
LMRPLGAIFLGAYIDRHGRRKGLIITLALMAMGTILIACVPGYAVLGVVAPLLVLLGRLL
QGFSAGVELGGVSVYLAEISTPGRKGFFVSWQSASQQAAVVFAGLLGVGLNHWLSPQEMG
DWGWRVPFLVGCMIVPAIFMIRRSLEETPEFQARKHRPSLSEIVRSIGQNFGIVLAGMAL
VVMTTVSFYLITAYTPTFGKAELNLSDLDALLVTVCIGLSNFFWLPVMGAFSDKIGRKPL
LLGATILAILTAYPALSWLVANPSFSHLLIVELWLSFLYGSYNGAMVVALTEIMPVEVRT
TGFSLAYSLATATFGGFTPAACTYLIHVLDNKAAPGIWLSGAAVLGLIATLVLFKGNRHE
LRTAQASMVSGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory