Comparing AO356_02815 FitnessBrowser__pseudo5_N2C3_1:AO356_02815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
2yjvC Crystal structure of e. Coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb (see paper)
56% identity, 96% coverage: 4:159/163 of query aligns to 2:157/158 of 2yjvC
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
43% identity, 91% coverage: 6:154/163 of query aligns to 7:155/156 of 1nxjA
>AO356_02815 FitnessBrowser__pseudo5_N2C3_1:AO356_02815
MNHYLTPDLCDAYPELVQVLEPMFSNFGGRDSFGGEIVTIKCFEDNSRVKEQVELKGNGK
VLVVDGGGSLRRALLGDMLAEKAAKNGWEGLVIYGCIRDVDVIAQTDLGVQALASHPMKT
DRRGVGELNVAVTFAGVTFRPGEYVYADNNGVIVSPSPLKMPE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory