Comparing AO356_03380 FitnessBrowser__pseudo5_N2C3_1:AO356_03380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P60664 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Escherichia coli (strain K12) (see paper)
37% identity, 94% coverage: 1:239/253 of query aligns to 1:239/258 of P60664
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
41% identity, 84% coverage: 1:213/253 of query aligns to 1:212/253 of 1gpwC
Sites not aligning to the query:
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
41% identity, 84% coverage: 1:213/253 of query aligns to 1:212/252 of 7ac8A
Sites not aligning to the query:
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
41% identity, 84% coverage: 1:213/253 of query aligns to 1:212/253 of Q9X0C6
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
44% identity, 83% coverage: 5:213/253 of query aligns to 6:215/253 of 1h5yB
Sites not aligning to the query:
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
41% identity, 84% coverage: 1:213/253 of query aligns to 1:203/244 of 3zr4E
Sites not aligning to the query:
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
40% identity, 83% coverage: 4:213/253 of query aligns to 4:212/250 of 7qc8A
5d2tA Directed evolutionary changes in kemp eliminase ke07 - crystal 3 wild type
39% identity, 90% coverage: 4:231/253 of query aligns to 2:227/251 of 5d2tA
6dnjA Directed evolutionary changes in kemp eliminase ke07 - crystal 28 round 5 (see paper)
38% identity, 91% coverage: 4:232/253 of query aligns to 3:229/250 of 6dnjA
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
40% identity, 84% coverage: 1:213/253 of query aligns to 1:198/237 of 2wjzE
4ewnD Structure of hisf-d130v+d176v with bound rcdrp (see paper)
40% identity, 83% coverage: 4:213/253 of query aligns to 3:205/243 of 4ewnD
Sites not aligning to the query:
3iivB Evolutionary optimization of computationally designed enzymes: kemp eliminases of the ke07 series (see paper)
39% identity, 92% coverage: 4:235/253 of query aligns to 4:230/262 of 3iivB
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
28% identity, 89% coverage: 4:228/253 of query aligns to 241:508/532 of 1ox5A
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
28% identity, 89% coverage: 4:228/253 of query aligns to 241:514/538 of 1ox4B
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 89% coverage: 4:228/253 of query aligns to 238:526/552 of P33734
3tdmA Computationally designed tim-barrel protein, halfflr (see paper)
43% identity, 37% coverage: 123:215/253 of query aligns to 1:92/120 of 3tdmA
Sites not aligning to the query:
5dn1A Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor (see paper)
28% identity, 83% coverage: 1:211/253 of query aligns to 1:205/240 of 5dn1A
P16250 Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16; EC 5.3.1.24 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
28% identity, 83% coverage: 1:211/253 of query aligns to 1:205/240 of P16250
4tx9A Crystal structure of hisap from streptomyces sviceus with degraded profar (see paper)
26% identity, 84% coverage: 1:212/253 of query aligns to 6:211/246 of 4tx9A
3zs4A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
28% identity, 75% coverage: 22:211/253 of query aligns to 23:208/244 of 3zs4A
Sites not aligning to the query:
>AO356_03380 FitnessBrowser__pseudo5_N2C3_1:AO356_03380
MQRKRVIPCLLLKDRGLVKTVKFKSPKYVGDPVNAIRIFNEKEVDELVLLDIEASILGRE
PDYELLAEVAGECFMPICYGGGIRTLEHAQRVFALGVEKIALNTAALADVELLRKIADQF
GSQSVVCSIDCKKSLLGRYSVYSQSGTKDTKVSPVEWAKRVEDAGAGEIFLNSIDRDGTM
QGFDIPLIKSVVAGVHIPVVACGGAGSIADLNEPFEKAGVSAVAAGSFFVFHGKHKAVLI
SYPDLNQSMSGSK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory