Comparing AO356_03405 FitnessBrowser__pseudo5_N2C3_1:AO356_03405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
93% identity, 99% coverage: 1:190/191 of query aligns to 1:190/191 of G3XD01
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
75% identity, 92% coverage: 6:181/191 of query aligns to 7:184/192 of 3mqgC
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
75% identity, 92% coverage: 6:181/191 of query aligns to 6:183/191 of 3mqhA
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
43% identity, 81% coverage: 13:166/191 of query aligns to 9:155/294 of 4mzuF
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
43% identity, 81% coverage: 13:166/191 of query aligns to 9:155/290 of 4mzuB
Sites not aligning to the query:
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
41% identity, 66% coverage: 13:138/191 of query aligns to 11:131/141 of 7s45A
7s42A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- galactose (see paper)
40% identity, 66% coverage: 13:138/191 of query aligns to 11:135/145 of 7s42A
7s41A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- glucose (see paper)
40% identity, 66% coverage: 13:138/191 of query aligns to 11:135/145 of 7s41A
7s3wA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d- galactose (see paper)
40% identity, 66% coverage: 13:138/191 of query aligns to 11:135/145 of 7s3wA
7s3uA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose (see paper)
40% identity, 66% coverage: 13:138/191 of query aligns to 11:135/145 of 7s3uA
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
34% identity, 71% coverage: 17:152/191 of query aligns to 89:219/259 of 3fscA
Sites not aligning to the query:
3fs8A Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with acetyl-coa (see paper)
34% identity, 71% coverage: 17:152/191 of query aligns to 89:219/259 of 3fs8A
Sites not aligning to the query:
3fsbA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-quinovose (see paper)
34% identity, 71% coverage: 17:152/191 of query aligns to 89:219/260 of 3fsbA
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
35% identity, 54% coverage: 48:150/191 of query aligns to 72:179/185 of 3nz2J
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
35% identity, 54% coverage: 48:150/191 of query aligns to 69:176/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
35% identity, 54% coverage: 48:150/191 of query aligns to 62:169/176 of 3ectA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
30% identity, 60% coverage: 36:150/191 of query aligns to 72:179/190 of 5u2kA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
27% identity, 74% coverage: 27:167/191 of query aligns to 138:255/258 of 4h7oA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
26% identity, 74% coverage: 27:167/191 of query aligns to 145:262/272 of 3gvdI
Sites not aligning to the query:
8e62C Structure of pcryo_0615 from psychrobacter cryohalolentis, an n- acetyltransferase required to produce diacetamido-2,3-dideoxy-d- glucuronic acid (see paper)
24% identity, 86% coverage: 6:170/191 of query aligns to 5:173/183 of 8e62C
>AO356_03405 FitnessBrowser__pseudo5_N2C3_1:AO356_03405
MSYYQHPSAIVDEGAQIGENSRVWHFVHVCAGARIGVGVSLGQNVFVGNKVVIGDRCKIQ
NNVSVYDNVTLEEGVFCGPSMVFTNVYNPRSLIERKDQYLDTLVKKGATLGANCTIVCGV
TIGEYAFVGAGAVINKDVPAYALMVGVPARQIGWMSEFGEQLQLNEQGEAFCSHTGARYV
LNGKLLNKTDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory