Comparing AO356_04615 FitnessBrowser__pseudo5_N2C3_1:AO356_04615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
2dvzA Structure of a periplasmic transporter (see paper)
27% identity, 85% coverage: 34:315/330 of query aligns to 8:284/300 of 2dvzA
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
27% identity, 67% coverage: 30:251/330 of query aligns to 2:215/302 of 8hkbA
Sites not aligning to the query:
7ndsA Crystal structure of tphc in a closed conformation (see paper)
23% identity, 69% coverage: 34:261/330 of query aligns to 6:221/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
23% identity, 69% coverage: 34:261/330 of query aligns to 6:221/293 of 7ndrD
>AO356_04615 FitnessBrowser__pseudo5_N2C3_1:AO356_04615
MNLSLRKIALAAGCLMFAGQLLAADPSKEPKRPECIAPASPGGGFDLTCKLVQSALVNQK
LLTKPMRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDESAVRW
LAAVGTSYGAIAVKSDSPYKNLDDLVQALKKDPGSVVIGSGGTVGSQDWMQTALIAKAAG
INPRDLRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGDMRLLAVFAEKRIDEPE
MKNIPTAREQGYDIVWPVVRGFYLGPKVSDEDYAWWKDAFDKLLASEEFAKLRDQRELFP
FAMTGPELDTYVKKQVADYKVLAKEFGLIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory