Comparing AO356_05050 FitnessBrowser__pseudo5_N2C3_1:AO356_05050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
91% identity, 94% coverage: 20:399/405 of query aligns to 1:380/380 of 2x5dD
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
36% identity, 94% coverage: 13:393/405 of query aligns to 9:387/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
36% identity, 94% coverage: 13:393/405 of query aligns to 9:387/392 of 6l1oB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
37% identity, 94% coverage: 13:393/405 of query aligns to 9:386/393 of 6l1nA
2o1bA Structure of aminotransferase from staphylococcus aureus
31% identity, 86% coverage: 38:386/405 of query aligns to 21:364/376 of 2o1bA
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
31% identity, 90% coverage: 27:391/405 of query aligns to 20:365/370 of Q58097
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
30% identity, 95% coverage: 12:396/405 of query aligns to 13:384/384 of 1o4sB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
28% identity, 94% coverage: 20:400/405 of query aligns to 17:388/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
28% identity, 94% coverage: 20:400/405 of query aligns to 17:388/388 of 1gd9A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
32% identity, 88% coverage: 32:387/405 of query aligns to 27:375/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
32% identity, 88% coverage: 32:387/405 of query aligns to 27:375/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
32% identity, 88% coverage: 32:387/405 of query aligns to 27:375/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
32% identity, 88% coverage: 32:387/405 of query aligns to 27:375/382 of 1b5oA
1j32A Aspartate aminotransferase from phormidium lapideum
30% identity, 96% coverage: 11:400/405 of query aligns to 5:384/388 of 1j32A
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
31% identity, 88% coverage: 32:387/405 of query aligns to 27:375/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
31% identity, 88% coverage: 32:387/405 of query aligns to 27:375/382 of 1gc3A
Sites not aligning to the query:
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
26% identity, 95% coverage: 13:395/405 of query aligns to 5:393/393 of 3jtxB
2o0rA The three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis (see paper)
30% identity, 93% coverage: 11:388/405 of query aligns to 1:378/385 of 2o0rA
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 83% coverage: 30:365/405 of query aligns to 35:379/410 of P58350
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
30% identity, 88% coverage: 33:387/405 of query aligns to 25:383/393 of 1xi9C
>AO356_05050 FitnessBrowser__pseudo5_N2C3_1:AO356_05050
MAEQGSPRRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGATPPHIVEKLVT
VAQREDTHGYSTSKGIPRLRRAISRWYKDRYEVDIDPETEAIVTIGSKEGLAHLMLATLD
QGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVPGVDFFDELERAIRGSIPKPKMMILGFP
SNPTAQCVELDFFERVIALAKQYDVLVIHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFF
TLSKSYNMAGWRIGFMVGNPELVNALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIA
EQYRQRRNVLVKGLHELGWMVENPKASMYVWAKIPEAYAHLGSLEFAKKLLAEAKVCVSP
GVGFGEYGDDHVRFALIENQDRIRQAVRGIRGMFRADGLVSKPNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory