Comparing AO356_05060 FitnessBrowser__pseudo5_N2C3_1:AO356_05060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1kofA Crystal structure of gluconate kinase (see paper)
39% identity, 79% coverage: 2:141/177 of query aligns to 3:142/171 of 1kofA
Sites not aligning to the query:
1ko8A Crystal structure of gluconate kinase (see paper)
39% identity, 79% coverage: 2:141/177 of query aligns to 3:142/172 of 1ko8A
1ko5A Crystal structure of gluconate kinase (see paper)
39% identity, 79% coverage: 2:141/177 of query aligns to 3:142/172 of 1ko5A
Sites not aligning to the query:
>AO356_05060 FitnessBrowser__pseudo5_N2C3_1:AO356_05060
MNNPISALVIMGVAGCGKTCVSQALCQLSGATAIEGDTFHPAANIQKMSAGIPLNDDDRA
GWLDSLCDELRRVDATGERPVLTCSALKHSYRERLRSALPGLGFVFLELPPEVAADRVSH
RPGHFMPSTLIDSQFATLESPVGEPLTLALDASSHSVDELAQQAYVWWLAHGLKLAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory