Comparing AO356_06055 FitnessBrowser__pseudo5_N2C3_1:AO356_06055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
51% identity, 98% coverage: 1:391/399 of query aligns to 1:388/393 of 3jtxB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
30% identity, 90% coverage: 32:392/399 of query aligns to 34:384/393 of 6l1nA
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
30% identity, 90% coverage: 32:392/399 of query aligns to 35:385/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
30% identity, 90% coverage: 32:392/399 of query aligns to 35:385/392 of 6l1oB
Sites not aligning to the query:
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
28% identity, 92% coverage: 32:399/399 of query aligns to 20:379/380 of 2x5dD
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
25% identity, 93% coverage: 29:398/399 of query aligns to 25:385/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
25% identity, 93% coverage: 29:398/399 of query aligns to 25:385/388 of 1gd9A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
28% identity, 91% coverage: 32:396/399 of query aligns to 40:383/384 of 1o4sB
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
30% identity, 82% coverage: 32:357/399 of query aligns to 34:352/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
30% identity, 82% coverage: 32:357/399 of query aligns to 34:352/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
30% identity, 82% coverage: 32:357/399 of query aligns to 34:352/382 of 1bjwA
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
30% identity, 82% coverage: 32:357/399 of query aligns to 34:352/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
30% identity, 82% coverage: 32:357/399 of query aligns to 34:352/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
30% identity, 82% coverage: 32:357/399 of query aligns to 34:352/382 of 1gc3A
Sites not aligning to the query:
1j32A Aspartate aminotransferase from phormidium lapideum
27% identity, 91% coverage: 33:396/399 of query aligns to 34:385/388 of 1j32A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
24% identity, 92% coverage: 30:397/399 of query aligns to 36:397/402 of P14909
Sites not aligning to the query:
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
30% identity, 82% coverage: 32:357/399 of query aligns to 28:334/368 of 1v2fA
Sites not aligning to the query:
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
30% identity, 82% coverage: 32:357/399 of query aligns to 28:334/368 of 1v2eA
Sites not aligning to the query:
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
26% identity, 92% coverage: 32:397/399 of query aligns to 44:408/410 of P58350
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
24% identity, 91% coverage: 32:394/399 of query aligns to 34:389/391 of 8wkjA
>AO356_06055 FitnessBrowser__pseudo5_N2C3_1:AO356_06055
MNNALNQLQPYPFEKLRALLGSVTPNPDKRPIALSIGEPKHRSPSFVAEALASNLEKMAV
YPTTLGIPELREAITGWCERRFNVPTGWLDPARHVLPVNGTREALFAFTQTVVNRGDDAL
VVSPNPFYQIYEGAAFLAGAKPHYLPCLDANGFNPDFDAVSPDIWKRCQILFLCSPGNPT
GALIPVDVLKKLIALADEHDFVIAADECYSELYFDEQTPPPGLLSACVELGRKDFKRCVV
FHSLSKRSNLPGLRSGFVAGDADILKGFLLYRTYHGCAMPVQTQLASIAAWNDEVHVRAN
RALYREKFDAVLEILSPVLDVQRPDGSFYLWPNVAGDDAAFCRDLFEQEHVTVVPGSYLS
RDVDGVNPGAGRVRMALVAPLAECVEAAERIRAFIQRRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory