SitesBLAST
Comparing AO356_06425 FitnessBrowser__pseudo5_N2C3_1:AO356_06425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 63% coverage: 34:310/437 of query aligns to 56:315/444 of Q8NLB7
- D57 (= D35) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R88) mutation to A: Loss of transport activity.
- W309 (= W304) mutation to V: Loss of transport activity.
- D312 (= D307) mutation to A: Loss of transport activity.
- R313 (= R308) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
25% identity, 83% coverage: 35:398/437 of query aligns to 123:487/554 of O15245
- L160 (≠ A71) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ C105) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A144) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ P164) mutation to F: Decreased TEA uptake.
- P283 (= P199) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (vs. gap) to G: in dbSNP:rs4646278
- P341 (≠ T248) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ L249) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (≠ F268) mutation to F: Decreased TEA uptake.
- Y376 (≠ F284) mutation to F: Decreased TEA uptake.
- G401 (= G310) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ I317) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (= M329) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (= M352) to I: in dbSNP:rs35956182
- V461 (= V371) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G375) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
24% identity, 74% coverage: 77:401/437 of query aligns to 160:489/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G138), W216 (= W141), Q240 (= Q165), W353 (≠ L261), Y360 (≠ F268), F378 (≠ E282), S381 (≠ L285), E385 (≠ C289), C449 (vs. gap), S469 (= S377)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
24% identity, 74% coverage: 77:401/437 of query aligns to 160:489/532 of 8et7A
Sites not aligning to the query:
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
29% identity, 38% coverage: 35:199/437 of query aligns to 105:265/453 of 8sc2A
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
24% identity, 74% coverage: 77:401/437 of query aligns to 162:491/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
23% identity, 74% coverage: 77:401/437 of query aligns to 162:491/555 of Q9R0W2
- C451 (≠ A361) Involved in recognition of organic cations and participates in structural changes that occur during translocation of organic cations; mutation to M: Transport activity strongly reduced.
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
29% identity, 38% coverage: 35:200/437 of query aligns to 105:266/447 of 8sc6A
Sites not aligning to the query:
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
24% identity, 74% coverage: 77:401/437 of query aligns to 162:491/556 of Q63089
- C179 (≠ T94) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ L135) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ G136) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L137) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G138) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G139) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ E140) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (= W141) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ G142) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ G143) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ A144) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ A145) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (≠ L146) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (= L147) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ A148) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (= T149) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E150) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ N151) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ A152) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
- S286 (vs. gap) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- S292 (= S203) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- T296 (≠ V207) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- C322 (≠ A228) mutation to S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- S328 (≠ K234) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- C358 (≠ I264) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- C418 (≠ G326) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- C437 (≠ P358) mutation to S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- C451 (vs. gap) mutation to M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- C470 (≠ A376) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- C474 (≠ Y380) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- D475 (≠ N381) mutation to E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; mutation to N: Decreased MPP(+) uptake.; mutation to R: Decreased MPP(+) uptake.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 155 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 37% coverage: 69:231/437 of query aligns to 182:330/616 of P36035
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 338 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
29% identity, 33% coverage: 35:178/437 of query aligns to 105:236/445 of 8sc3A
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
21% identity, 70% coverage: 125:429/437 of query aligns to 137:478/514 of Q9LT15
- E162 (= E150) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q165) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ F172) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (vs. gap) binding
- Q296 (vs. gap) binding
- N301 (≠ C258) binding
- N332 (≠ M295) binding
- D344 (= D307) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (≠ A361) binding
- C449 (≠ V399) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
Sites not aligning to the query:
- 39 F→A: Reduces affinity for glucose 8-fold.
- 43 L→A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- 77 modified: Disulfide link with 449; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
21% identity, 70% coverage: 125:429/437 of query aligns to 117:458/487 of 7aaqA
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 34% coverage: 77:226/437 of query aligns to 98:254/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Query Sequence
>AO356_06425 FitnessBrowser__pseudo5_N2C3_1:AO356_06425
MTTATCNEAVPAQPTNSATRVATASFIGTAIEFYDFYVYATAAALVIGPVFFPQTSGTAQ
MLSSFLTFGIAFLARPLGSALFGHFGDRIGRKSTLVASLLLMGVCTTLIGVLPGYASIGA
WAPILLCLLRFGQGLGLGGEWGGAALLATENAPKGKRAWFGMFPQLGPSIGFLAANGLFL
TLAMSLDDEQFRDWGWRIPFLLSAVLVIVGLYVRLKLHETPVFANAMARQERVKVPLVEL
FSQYWAPTLLGAAAMVVCYALFYISTVFSLSYGVSTLGYSRETFLGLLCFAVLFMAAATP
LSAWASDRYGRKPILIIGGLLAIASGFLMEPLLTHGSTGGVALFLCIELFLMGVTFAPMG
ALLPELFPTHVRYTGASAAYNLGGIVGASAAPFFAQKLVAMGGLSYVGGYVSAAALLSVI
AVLCLKETRHNDLNRVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory