Comparing AO356_06880 FitnessBrowser__pseudo5_N2C3_1:AO356_06880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
53% identity, 99% coverage: 1:328/331 of query aligns to 9:335/336 of A3QCW5
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
28% identity, 90% coverage: 25:323/331 of query aligns to 4:302/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
28% identity, 90% coverage: 25:323/331 of query aligns to 3:301/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
28% identity, 90% coverage: 25:323/331 of query aligns to 3:301/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
28% identity, 90% coverage: 25:323/331 of query aligns to 3:301/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
28% identity, 90% coverage: 25:323/331 of query aligns to 3:301/310 of 7bcnA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
26% identity, 89% coverage: 19:314/331 of query aligns to 19:313/328 of Q0B2F6
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
25% identity, 87% coverage: 28:314/331 of query aligns to 2:287/301 of 4n17A
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
25% identity, 87% coverage: 28:314/331 of query aligns to 2:287/301 of 4n15A
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
28% identity, 90% coverage: 30:327/331 of query aligns to 6:310/314 of 4p8bA
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
28% identity, 84% coverage: 36:312/331 of query aligns to 11:283/301 of 4mhfA
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
28% identity, 84% coverage: 36:312/331 of query aligns to 11:283/302 of 4mijA
Sites not aligning to the query:
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
28% identity, 84% coverage: 36:312/331 of query aligns to 41:313/330 of Q128M1
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
27% identity, 90% coverage: 28:326/331 of query aligns to 3:299/303 of 4pddA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
25% identity, 86% coverage: 27:312/331 of query aligns to 4:287/304 of 4x8rA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
27% identity, 96% coverage: 1:317/331 of query aligns to 1:314/329 of P44542
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
28% identity, 80% coverage: 58:322/331 of query aligns to 34:295/300 of 7t3eA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
27% identity, 82% coverage: 48:317/331 of query aligns to 25:292/303 of 4p9kA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
27% identity, 82% coverage: 48:317/331 of query aligns to 26:293/304 of 4pakA
Sites not aligning to the query:
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
27% identity, 87% coverage: 29:317/331 of query aligns to 4:290/305 of 2cexB
Sites not aligning to the query:
>AO356_06880 FitnessBrowser__pseudo5_N2C3_1:AO356_06880
MLKPVWKALACTLAFGAWGTAMAAEPIVIKFSHVVGDQTPKGQGALMFKKLTEERLPGKV
KVEVYPNSTLYGDDKEMEALLLGEVQIIARSLAKFDQYTKTVQLFDLPFLFDDIAAVDRF
QQSPEGQKLLKSMESKNVIGLAYWHNGMKQLSASKPLRTPEDARGLTFRIQTSAVLEEQF
KAVDAKAKPMIFSVVYQGLRTGLVNGTENTYSNFYNQKLNEVQKYVTESNHGILDYMLIT
TSDFWNGLPPDIRSELDQIVVESTAHANQEAEKFNQQDKQHVLDAKTTEIITLTPQERSV
WRERMKPVWAKFEKEIGPDLIKAAEASNSAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory