Comparing AO356_07100 FitnessBrowser__pseudo5_N2C3_1:AO356_07100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
43% identity, 93% coverage: 3:268/287 of query aligns to 39:302/307 of Q94JV5
Sites not aligning to the query:
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
33% identity, 93% coverage: 3:269/287 of query aligns to 5:299/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
33% identity, 93% coverage: 3:269/287 of query aligns to 5:299/304 of 4hg3A
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 93% coverage: 3:269/287 of query aligns to 8:302/307 of P47016
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
33% identity, 93% coverage: 3:269/287 of query aligns to 4:295/299 of 4hgdA
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
32% identity, 93% coverage: 3:269/287 of query aligns to 6:265/276 of Q9NQR4
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 96% coverage: 13:287/287 of query aligns to 49:346/355 of P46011
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
28% identity, 84% coverage: 3:243/287 of query aligns to 11:234/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
28% identity, 84% coverage: 3:243/287 of query aligns to 5:228/263 of 7ovgA
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 87% coverage: 3:253/287 of query aligns to 3:237/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 87% coverage: 3:253/287 of query aligns to 3:237/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
29% identity, 87% coverage: 3:251/287 of query aligns to 4:236/262 of Q9UYV8
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
23% identity, 93% coverage: 3:269/287 of query aligns to 11:284/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
23% identity, 93% coverage: 3:269/287 of query aligns to 7:280/297 of 5h8jB
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
22% identity, 93% coverage: 3:269/287 of query aligns to 8:281/298 of 5h8lB
7slyA Vanin-1 complexed with compound 27 (see paper)
27% identity, 56% coverage: 1:162/287 of query aligns to 14:194/461 of 7slyA
Sites not aligning to the query:
7slxA Vanin-1 complexed with compound 11 (see paper)
27% identity, 56% coverage: 1:162/287 of query aligns to 14:194/461 of 7slxA
Sites not aligning to the query:
7slvA Vanin-1 complexed with compound 3 (see paper)
27% identity, 56% coverage: 1:162/287 of query aligns to 14:194/461 of 7slvA
Sites not aligning to the query:
4cygA The structure of vanin-1: defining the link between metabolic disease, oxidative stress and inflammation (see paper)
27% identity, 56% coverage: 1:162/287 of query aligns to 16:196/463 of 4cygA
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
26% identity, 75% coverage: 24:237/287 of query aligns to 31:260/304 of Q44185
>AO356_07100 FitnessBrowser__pseudo5_N2C3_1:AO356_07100
MPVAVIQMVSQSDVLANLARARVLLEQAAAGGARLAVLPENFAAMGRRDIADIGRAEAFG
QGPILPWLKQVARDLKLWIVAGTLPLPPVDQPEARSHACSLLVDDQGQIVARYDKLHLFD
VDVADNRGRYRESDDYAYGANVVVADTPVGRVGLTVCYDLRFPELYSELRAAGAELITAP
SAFTAVTGAAHWDVLIRARAIETQCYVLAAAQGGVHPGPRETFGHAAIVDPWGRVLAQQD
QGEAVLVAERDSSEQASIRARMPVASHRRFFSQGARQRPVQDDEFKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory