Comparing AO356_07720 FitnessBrowser__pseudo5_N2C3_1:AO356_07720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
38% identity, 98% coverage: 1:316/323 of query aligns to 1:321/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
38% identity, 91% coverage: 28:320/323 of query aligns to 21:320/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
38% identity, 91% coverage: 28:320/323 of query aligns to 20:309/310 of 4fwiB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 75% coverage: 21:262/323 of query aligns to 11:248/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 75% coverage: 21:262/323 of query aligns to 12:249/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 75% coverage: 21:262/323 of query aligns to 12:249/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 75% coverage: 21:262/323 of query aligns to 12:249/344 of 3tuiC
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 71% coverage: 29:258/323 of query aligns to 17:247/250 of 7z18I
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 71% coverage: 29:258/323 of query aligns to 17:247/253 of 7z15I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 71% coverage: 29:258/323 of query aligns to 17:247/250 of 7z16I
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 72% coverage: 28:258/323 of query aligns to 16:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 72% coverage: 28:258/323 of query aligns to 16:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 72% coverage: 28:258/323 of query aligns to 16:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
34% identity, 72% coverage: 28:258/323 of query aligns to 16:241/242 of 2oljA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 71% coverage: 31:260/323 of query aligns to 18:241/241 of 4u00A
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 77% coverage: 31:278/323 of query aligns to 42:285/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 77% coverage: 31:278/323 of query aligns to 42:285/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
35% identity, 68% coverage: 30:250/323 of query aligns to 41:258/260 of 7ahdC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 72% coverage: 34:264/323 of query aligns to 36:257/378 of P69874
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 72% coverage: 28:259/323 of query aligns to 19:247/375 of 2d62A
>AO356_07720 FitnessBrowser__pseudo5_N2C3_1:AO356_07720
MTLLHVKDLQVRFAAPGSGPFGINRQWVKAVNGVSLSLAAGEVLGLVGESGSGKSTLGRA
ILRLTEVSAGQILFDGVDMAQGKRIDIERLRHETAMIFQDPYTALNPRMSIGDTLAEVLR
VRCAIPASLIRQRVDELLNLVGLRPELAHRKPGSLSGGQCQRVGIARALAIEPRLIIADE
CVAALDVSIQGQIINLLLELRQRMNLAILFIAHDLAIVRRLCDRVAVMYLGEIVEQGPTE
TVFSSPRHPYTVALIQSIPHIDPTRPLLSAPLPGEPPSPLNLPSGCVFHPRCRYAQPICA
KTPPPSHDINGHRYSCVLGEPLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory