SitesBLAST
Comparing AO356_08030 FitnessBrowser__pseudo5_N2C3_1:AO356_08030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 86% coverage: 12:407/460 of query aligns to 18:404/448 of Q51955
- D41 (= D35) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D38) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G79) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D83) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G86) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R118) mutation to A: Abolishes 4-HBA transport.
- E144 (= E138) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R177) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (≠ E323) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ K328) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R389) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R401) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
29% identity, 95% coverage: 3:438/460 of query aligns to 2:421/452 of Q5EXK5
- D82 (= D83) mutation to A: Loss of activity.
- V311 (≠ W320) mutation to W: Loss of activity.
- D314 (≠ E323) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
29% identity, 94% coverage: 24:456/460 of query aligns to 13:403/403 of P77589
- E27 (≠ D35) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D83) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ W320) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R324) mutation to D: Lack of 3HPP transport activity.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 59% coverage: 23:292/460 of query aligns to 167:474/742 of Q02563
- DMCLS 196:200 (≠ EFGLS 52:56) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. gap) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 88% coverage: 12:415/460 of query aligns to 31:400/444 of Q8NLB7
- D54 (= D35) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D38) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R84) mutation to A: Loss of transport activity.
- W309 (= W320) mutation to V: Loss of transport activity.
- D312 (≠ E323) mutation to A: Loss of transport activity.
- R313 (= R324) mutation to A: Loss of transport activity.
- I317 (vs. gap) mutation I->H,Y: Loss of transport activity.
- R386 (= R401) mutation to A: Loss of transport activity.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 88% coverage: 49:454/460 of query aligns to 33:434/446 of A0A0H2VG78
- R102 (= R118) mutation to A: Loss of transport activity.
- I105 (≠ L121) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E138) mutation to A: Loss of transport activity.
- Q137 (≠ D153) mutation to A: Loss of transport activity.
- Q250 (≠ F274) mutation to A: Loss of transport activity.
- Q251 (≠ A275) mutation to A: Loss of transport activity.
- N256 (≠ Y280) mutation to A: Loss of transport activity.
- W357 (≠ Y377) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
26% identity, 79% coverage: 46:408/460 of query aligns to 113:472/548 of Q9VCA2
Sites not aligning to the query:
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
O76082 Organic cation/carnitine transporter 2; High-affinity sodium-dependent carnitine cotransporter; Solute carrier family 22 member 5 from Homo sapiens (Human) (see 21 papers)
27% identity, 79% coverage: 46:408/460 of query aligns to 125:478/557 of O76082
- E131 (= E52) to D: in CDSP; uncertain significance; may affect splicing; reduces carnitine transport but the mutant retains 30% of wild-type activity
- A142 (= A60) to S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 25% of wild-type activity; dbSNP:rs151231558
- P143 (≠ G61) to L: in CDSP; carnitine transport reduced to less than 2% of wild-type; dbSNP:rs1178584184
- L144 (= L62) to F: in dbSNP:rs10040427
- V151 (≠ F69) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs386134193
- R169 (= R87) to P: in CDSP; loss of carnitine transport; to Q: in CDSP; loss of carnitine transport; dbSNP:rs121908889; to W: in CDSP; loss of carnitine transport; dbSNP:rs121908890
- V175 (≠ W93) to M: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs781721860
- M177 (≠ I95) to V: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs145068530
- M179 (≠ L97) to L: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs386134196
- L186 (= L104) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134197
- M205 (≠ I123) to R: in CDSP; loss of carnitine transport; dbSNP:rs796052033
- N210 (≠ E128) to S: in CDSP; loss of carnitine transport; dbSNP:rs386134198
- Y211 (≠ F129) to C: in CDSP; loss of carnitine transport; dbSNP:rs121908888
- A214 (= A132) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134199
- T219 (≠ S137) to K: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity
- S225 (≠ K143) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs386134205
- R227 (= R145) to H: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs185551386
- F230 (≠ Y148) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs756650860
- S231 (≠ I149) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134206
- T232 (≠ A150) to M: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs114269482
- A240 (≠ P157) to T: in CDSP; reduces carnitine transport to less than 2% of wild-type activity
- G242 (= G159) to V: in CDSP; loss of carnitine transport; dbSNP:rs72552728
- P247 (≠ G164) to R: in CDSP; loss of carnitine transport
- R254 (≠ I174) to Q: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 30% of wild-type activity; dbSNP:rs200699819
- R257 (= R177) to W: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs386134203
- T264 (≠ A184) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs201262157; to R: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs201262157
- L269 (≠ F189) to P: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity
- S280 (= S200) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs386134208
- R282 (= R202) to Q: in CDSP; reduces carnitine transport to 5% of wild-type activity; dbSNP:rs386134210
- W283 (= W203) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134211; to R: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs72552729
- A301 (≠ E221) to D: in CDSP; reduces carnitine transport to less-than-1% to 3% of wild-type activity; dbSNP:rs72552730
- I312 (≠ L233) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 70% of wild-type activity; dbSNP:rs77300588
- E317 (≠ R238) to K: in CDSP; uncertain significance; no effect on carnitine transport; dbSNP:rs774792831
- I348 (≠ W269) to T: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 60% of wild-type activity; dbSNP:rs150544263
- W351 (= W272) to R: in CDSP; loss of carnitine transport; dbSNP:rs68018207
- M352 (≠ F273) mutation to R: Loss of both carnitine and organic cation transport functionalities. No effect on protein expression.
- S355 (≠ L276) to L: in CDSP; reduces carnitine transport to less than 2% of wild-type activity; dbSNP:rs1385634398
- Y358 (≠ F279) to N: in CDSP; loss of carnitine transport; dbSNP:rs61731073
- L363 (≠ W285) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134214
- L394 (≠ E323) natural variant: Missing (in CDSP; reduces carnitine transport to 5% of wild-type activity)
- P398 (vs. gap) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs144547521
- R399 (≠ G326) to Q: in CDSP; carnitine transport is reduced to less than 1% of normal; dbSNP:rs121908891; to W: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs267607054
- S412 (≠ G339) to G: in CDSP; uncertain significance; no effect on carnitine transport
- V439 (≠ L369) to G: in CDSP; reduces carnitine transport to less than 1% of wild-type activity
- T440 (≠ F370) to M: in CDSP; loss of carnitine transport; dbSNP:rs72552732
- A442 (≠ M372) to I: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs267607053
- F443 (≠ W373) to V: in CDSP; reduces carnitine transport to less than 1% of wild-type
- V446 (≠ L376) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type; dbSNP:rs72552733
- Y447 (= Y377) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134218
- V448 (≠ T378) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs386134219
- Y449 (= Y379) to D: in CDSP; uncertain significance; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs11568514
- E452 (= E382) to K: in CDSP; reduces carnitine transport to less than 5% of wild-type; dbSNP:rs72552734
- P455 (= P385) to R: in CDSP; loss of carnitine transport; dbSNP:rs1408166345
- G462 (= G392) to V: in CDSP; reduces carnitine transport to less than 5% of wild-type
- S467 (= S397) to C: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs60376624
- T468 (≠ A398) to R: in CDSP; markedly reduced carnitine transport compared to the wild-type protein; less than 1% of wild-type activity; dbSNP:rs386134221
- S470 (≠ G400) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134222
- R471 (= R401) to H: in CDSP; reduces carnitine transport to less than 2% of wild-type; dbSNP:rs386134223; to P: in CDSP; loss of carnitine transport
- L476 (= L406) to R: in CDSP; loss of carnitine transport
- P478 (= P408) to L: in CDSP; loss of carnitine transport but stimulated organic cation transport; no effect on protein expression; dbSNP:rs72552735
Sites not aligning to the query:
- 12 G → S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs139203363
- 15 G → W: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs267607052
- 16 P → L: in CDSP; loss of carnitine transport
- 17 F → L: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs11568520
- 19 R → P: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs72552723
- 20 L → H: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs144020613
- 22 natural variant: Missing (in CDSP; reduces carnitine transport to less than 1% of normal)
- 26 S → N: in CDSP; carnitine transport reduced to less than 6% of wild-type; dbSNP:rs772578415
- 28 S → I: in CDSP; carnitine transport reduced to 1% of wild-type; dbSNP:rs72552724
- 32 N → S: in CDSP; carnitine transport reduced to less than 1% of wild-type; dbSNP:rs72552725
- 44 A → V: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs199689597
- 46 P → L: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs377767445; P → S: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs202088921
- 50 C → Y: in CDSP; loss of carnitine transport
- 57 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 66 T → P: in CDSP; carnitine transport reduced to 2% of wild-type
- 75 R → P: in CDSP; carnitine transport reduced to 2% of wild-type; dbSNP:rs757711838
- 83 R → L: in CDSP; loss of carnitine transport; dbSNP:rs72552726
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Reduces expression to 50%. No effect on carnitine transporter activity.
- 93 S → W: in CDSP; loss of carnitine transport; dbSNP:rs386134190
- 95 L → V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134191
- 96 G → A: in CDSP; carnitine transport reduced to 20% of wild-type; dbSNP:rs377767450
- 115 D → G: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs386134192
- 123 V → G: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs748605096
- 481 V → F: reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs11568513; V → I: in dbSNP:rs11568513
- 488 R → C: in CDSP; reduces carnitine transport to less than 10% of wild-type; dbSNP:rs377216516; R → H: in CDSP; uncertain significance; reduces carnitine transport to 40% of wild-type; dbSNP:rs28383481
- 507 L → S: in CDSP; reduces carnitine transport to 5% of wild-type; dbSNP:rs1157198543
- 508 F → L: in dbSNP:rs11568521
- 530 M → V: in dbSNP:rs11568524
- 549 P → S: reduces carnitine transport but the mutant retains more than 20% of wild-type activity; dbSNP:rs11568525
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
27% identity, 58% coverage: 24:292/460 of query aligns to 154:460/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
27% identity, 58% coverage: 24:291/460 of query aligns to 154:459/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 99% coverage: 1:455/460 of query aligns to 24:546/572 of O42885
- S292 (= S227) modified: Phosphoserine
- S296 (≠ R231) modified: Phosphoserine
Sites not aligning to the query:
- 12 modified: Phosphoserine
- 14 modified: Phosphoserine
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 95% coverage: 19:455/460 of query aligns to 59:555/587 of P25297
- K298 (≠ R219) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
27% identity, 83% coverage: 70:452/460 of query aligns to 126:486/497 of 8bw7A
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
27% identity, 83% coverage: 70:452/460 of query aligns to 126:490/502 of 8bvsA
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
27% identity, 83% coverage: 70:452/460 of query aligns to 135:499/508 of 8bvtA
Sites not aligning to the query:
Q8VC69 Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; mNKT; Organic anion transporter 1; mOAT1; Renal organic anion transporter 1; mROAT1 from Mus musculus (Mouse) (see 2 papers)
26% identity, 85% coverage: 63:452/460 of query aligns to 130:508/545 of Q8VC69
- C183 (≠ T115) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C434 (≠ V375) mutation to A: Decreased cell surface expression level and PAH transport activity. 80% decrease of PAH transport activity; when associated with A-49; A-122 and A-183. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402 and A-427.
Sites not aligning to the query:
- 39 N→Q: Complete loss of PAH transport activity.
- 49 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 86 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 107 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 122 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
25% identity, 86% coverage: 61:454/460 of query aligns to 58:475/491 of P0AGF4
- G83 (= G86) mutation to A: Abolishes xylose transport.
- R133 (= R118) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E138) mutation to A: Abolishes xylose transport.
- R160 (= R145) mutation to A: Abolishes xylose transport.
- Q168 (≠ D153) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ S258) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ SP 258:259) binding
- Q289 (≠ P259) mutation to A: Strongly decreases xylose transport.
- N294 (≠ R264) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ I268) mutation to A: Abolishes xylose transport.
- N325 (≠ G311) mutation to A: No effect on xylose transport.
- G340 (= G326) mutation to A: Abolishes xylose transport.
- R341 (= R327) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ Y377) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E382) mutation to A: Abolishes xylose transport.
- R404 (= R389) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ S404) binding
- W416 (≠ L405) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
25% identity, 86% coverage: 61:454/460 of query aligns to 54:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
25% identity, 86% coverage: 61:454/460 of query aligns to 54:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
25% identity, 86% coverage: 61:454/460 of query aligns to 54:471/475 of 4gbyA
Query Sequence
>AO356_08030 FitnessBrowser__pseudo5_N2C3_1:AO356_08030
MDTHGYSAAERLERLPISGYHRVIFIIIALAFFFDSMDLAMMTFLLGSIKAEFGLSTAQA
GLLASSSFFGMVLGASLSGMLADRFGRKPVFQWSIVLWGIASYLCSTAQDVETLTLFRIL
LGIGMGMEFPIAQSMLSELIPAKRRGRYIALMDGFWPLGFVAAGVLSYFLLPVIGWRDIF
LVLAVPAVFVLAIRFFIPESPRWLEQAGRGDEADAVLKRIEDKVRASLGRRELPEPIRLP
RVESTPGNFFSALAQIWSPLYRQRTMMIWSVWFFALLGFYGLTSWLSALLQQSGFAVTQS
VYYTVLISLGGIPGFLMAAWLVERWGRKPVCIITLLGGGVMAFLYGQSAVFGGNVGLLIG
TGLLMQFFLFGMWAVLYTYTPELYPTSARATGSGFASAVGRIGSLLGPLVTGLVFPITGQ
GGVFALGALCFAVAAGVVWVFGMETRGKTLEELSEATAAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory