Comparing AO356_08355 AO356_08355 ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 84% coverage: 45:285/286 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 84% coverage: 45:285/286 of query aligns to 4:253/254 of 1g6hA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 84% coverage: 45:284/286 of query aligns to 4:239/280 of 5x40A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 78% coverage: 60:282/286 of query aligns to 20:237/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 78% coverage: 60:282/286 of query aligns to 20:237/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 78% coverage: 60:282/286 of query aligns to 20:237/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
33% identity, 78% coverage: 60:282/286 of query aligns to 20:237/353 of Q97UY8
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 85% coverage: 44:285/286 of query aligns to 1:235/240 of 6mjpA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
29% identity, 85% coverage: 45:286/286 of query aligns to 4:240/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 76% coverage: 58:273/286 of query aligns to 18:228/343 of P30750
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
27% identity, 84% coverage: 46:285/286 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
27% identity, 84% coverage: 46:285/286 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
27% identity, 84% coverage: 46:285/286 of query aligns to 3:235/238 of 6s8gA
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 76% coverage: 58:273/286 of query aligns to 19:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 76% coverage: 58:273/286 of query aligns to 19:229/344 of 3tuiC
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
27% identity, 84% coverage: 46:285/286 of query aligns to 4:236/241 of 6mbnA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 78% coverage: 46:269/286 of query aligns to 4:217/369 of P19566
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 76% coverage: 58:273/286 of query aligns to 19:229/344 of 6cvlD
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
27% identity, 84% coverage: 46:284/286 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
27% identity, 84% coverage: 46:284/286 of query aligns to 3:234/234 of 4p31A
>AO356_08355 AO356_08355 ABC transporter ATP-binding protein
MRITPTADFMLEPILEPNKDQGSSRDAIGLGQAAGVGLNTRHGTILTLEDISVSFDGFKA
LNDLNLYIGVGELRCIIGPNGAGKTTLMDVITGKTRPSHGKAWFGETLDLTSMSEVQIAQ
AGIGRKFQKPTVFEALSVFENLELALKTDKSVWASLRARLTGEQHDRIDEVLETIRLTTS
VNRAAGLLSHGQKQFLEIGMLLVQDPQLLLLDEPVAGMTDAETEFTAELFKSLAGKHSLM
VVEHDMGFVGAIADHVTVLHQGSVLAEGSLEQVQDNERVIEVYLGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory