SitesBLAST
Comparing AO356_09100 FitnessBrowser__pseudo5_N2C3_1:AO356_09100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
39% identity, 99% coverage: 3:248/249 of query aligns to 5:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ G15), R18 (≠ S16), I20 (= I18), T40 (vs. gap), N62 (≠ D63), V63 (= V64), N89 (= N90), A90 (= A91), I92 (≠ M93), V139 (= V140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I187 (= I188), T189 (= T190), M191 (≠ L192)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 98% coverage: 5:248/249 of query aligns to 3:246/246 of 3osuA
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
38% identity, 94% coverage: 6:240/249 of query aligns to 4:236/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M16 (≠ I18), D35 (= D37), I36 (≠ R38), I62 (≠ V64), N88 (= N90), G90 (= G92), I138 (≠ V140), S140 (= S142), Y152 (= Y155), K156 (= K159), I185 (= I188)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
38% identity, 94% coverage: 6:240/249 of query aligns to 5:237/248 of Q9KJF1
- S15 (= S16) binding
- D36 (= D37) binding
- D62 (= D63) binding
- I63 (≠ V64) binding
- N89 (= N90) binding
- Y153 (= Y155) binding
- K157 (= K159) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
36% identity, 93% coverage: 1:232/249 of query aligns to 1:245/261 of 6zzsD
- active site: G18 (= G17), S143 (= S142), Y156 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (= S16), I19 (= I18), D38 (= D37), M39 (≠ R38), D64 (= D63), V65 (= V64), N91 (= N90), A92 (= A91), G93 (= G92), M141 (≠ V140), A142 (= A141), S143 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), V189 (≠ I188), T191 (= T190), L193 (= L192)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ L94), S143 (= S142), N145 (≠ L144), K153 (≠ L152), Y156 (= Y155), Q197 (≠ I196)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
37% identity, 91% coverage: 7:232/249 of query aligns to 7:244/260 of 6zzqA
- active site: G17 (= G17), S142 (= S142), Y155 (= Y155)
- binding acetoacetic acid: Q94 (≠ L94), S142 (= S142), K152 (≠ L152), Y155 (= Y155), Q196 (≠ I196)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), S16 (= S16), G17 (= G17), I18 (= I18), D37 (= D37), M38 (≠ R38), D63 (= D63), V64 (= V64), N90 (= N90), A91 (= A91), G92 (= G92), M140 (≠ V140), A141 (= A141), S142 (= S142), Y155 (= Y155), K159 (= K159), Y187 (≠ P187), V188 (≠ I188), T190 (= T190)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
39% identity, 99% coverage: 3:248/249 of query aligns to 5:242/243 of 4i08A
- active site: G19 (= G17), N113 (≠ D114), S141 (= S142), Q151 (≠ L152), Y154 (= Y155), K158 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ G15), R18 (≠ S16), I20 (= I18), T40 (vs. gap), N62 (≠ D63), V63 (= V64), N89 (= N90), A90 (= A91), G140 (≠ A141), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), T189 (= T190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 97% coverage: 7:248/249 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G17), S138 (= S142), Q148 (≠ L152), Y151 (= Y155), K155 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ G15), R11 (≠ S16), I13 (= I18), N31 (≠ T36), Y32 (≠ D37), A33 (≠ R38), G34 (vs. gap), S35 (≠ D39), A58 (= A62), N59 (≠ D63), V60 (= V64), N86 (= N90), A87 (= A91), T109 (≠ V113), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 96% coverage: 9:248/249 of query aligns to 8:243/244 of P0AEK2
- GASR 12:15 (≠ GAGS 13:16) binding
- T37 (≠ R38) binding
- NV 59:60 (≠ CV 60:61) binding
- N86 (= N90) binding
- Y151 (= Y155) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (= YAAAK 155:159) binding
- A154 (= A158) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K159) mutation to A: Defect in the affinity for NADPH.
- I184 (= I188) binding
- E233 (≠ Q238) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
39% identity, 96% coverage: 9:248/249 of query aligns to 7:242/243 of 1q7bA
- active site: G15 (= G17), E101 (≠ M106), S137 (= S142), Q147 (≠ L152), Y150 (= Y155), K154 (= K159)
- binding calcium ion: E232 (≠ Q238), T233 (= T239)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), R14 (≠ S16), T36 (≠ R38), N58 (≠ C60), V59 (= V61), N85 (= N90), A86 (= A91), G87 (= G92), I88 (≠ M93), S137 (= S142), Y150 (= Y155), K154 (= K159), P180 (= P185), G181 (= G186), I183 (= I188)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
38% identity, 96% coverage: 10:248/249 of query aligns to 8:242/243 of 7emgB
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 100% coverage: 1:248/249 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (≠ D114), S139 (= S142), Q149 (≠ L152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ Q96), K98 (≠ E101), S139 (= S142), N146 (≠ G149), V147 (≠ A150), Q149 (≠ L152), Y152 (= Y155), F184 (≠ P187), M189 (≠ L192), K200 (≠ A203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ R38), V59 (≠ A62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ M93), T137 (≠ V140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ P187), T185 (≠ I188), T187 (= T190), M189 (≠ L192)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
38% identity, 96% coverage: 9:248/249 of query aligns to 8:243/244 of 6t77A
- active site: G16 (= G17), S138 (= S142), Y151 (= Y155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ S16), T37 (≠ R38), L58 (≠ E59), N59 (≠ C60), V60 (= V61), A87 (= A91), G88 (= G92), I89 (≠ M93)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
38% identity, 96% coverage: 9:248/249 of query aligns to 7:242/243 of 1q7cA
- active site: G15 (= G17), S137 (= S142), Q147 (≠ L152), F150 (≠ Y155), K154 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), R14 (≠ S16), A35 (≠ D37), T36 (≠ R38), L57 (≠ E59), N58 (≠ C60), V59 (= V61), G87 (= G92), I88 (≠ M93)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 96% coverage: 9:248/249 of query aligns to 8:243/244 of P0A2C9
- M125 (= M129) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A227) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S228) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 97% coverage: 7:248/249 of query aligns to 6:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S142), Q152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ S16), G16 (= G17), I17 (= I18), N35 (≠ T36), Y36 (vs. gap), N37 (≠ D37), G38 (≠ R38), S39 (≠ D39), N63 (≠ D63), V64 (= V64), N90 (= N90), A91 (= A91), I93 (≠ M93), I113 (≠ V113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (= I188), T190 (= T190)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
39% identity, 97% coverage: 4:245/249 of query aligns to 2:256/260 of 2ztlA
- active site: G15 (= G17), N114 (≠ D114), S142 (= S142), Y155 (= Y155), K159 (= K159), L200 (vs. gap)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ L94), S142 (= S142), H144 (≠ L144), K152 (≠ L152), Y155 (= Y155), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), G15 (= G17), I16 (= I18), F36 (vs. gap), L64 (≠ V64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (≠ V113), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (≠ P187), V188 (≠ I188), T190 (= T190), V193 (= V193)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
39% identity, 97% coverage: 4:245/249 of query aligns to 2:256/260 of 1wmbA
Sites not aligning to the query:
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 92% coverage: 1:229/249 of query aligns to 2:236/255 of 5itvA
- active site: G18 (= G17), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (≠ R38), T61 (≠ A62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (≠ V140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I186 (≠ P187), I187 (= I188)
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
38% identity, 93% coverage: 9:240/249 of query aligns to 7:250/259 of 1w4zA
- active site: G15 (= G17), N112 (≠ D114), S142 (= S142), Y155 (= Y155), K159 (= K159), Y200 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), T13 (≠ G15), S14 (= S16), G15 (= G17), I16 (= I18), R36 (= R38), G37 (≠ D39), D61 (= D63), V62 (= V64), N88 (= N90), G90 (= G92), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), V188 (≠ I188), T190 (= T190)
Query Sequence
>AO356_09100 FitnessBrowser__pseudo5_N2C3_1:AO356_09100
MQQLFNRRAVITGAGSGIGAAIARAYAAQGARLVLTDRDAERLSATANDCRALSVEVYEC
VADVGSVEGAQAGVDACVEQFGGIDILVNNAGMLTQARCTELSIEMWNDMLRVDLTSVFI
ASQRALPHMLAQRWGRIINVASQLGIKGGAELSHYAAAKAGVIGFTKSLALEVAADNVLV
NAIAPGPIETPLVAGISESWKQAKSAELPLRRFGLATEVAPTAVLLASDPGGNLFVGQTL
GPNAGDVMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory