Comparing AO356_09275 FitnessBrowser__pseudo5_N2C3_1:AO356_09275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
30% identity, 95% coverage: 2:290/303 of query aligns to 2:291/291 of 3na8A
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
29% identity, 94% coverage: 3:288/303 of query aligns to 2:287/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
29% identity, 94% coverage: 3:288/303 of query aligns to 2:287/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
29% identity, 94% coverage: 3:288/303 of query aligns to 2:287/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
29% identity, 94% coverage: 3:288/303 of query aligns to 2:287/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
29% identity, 94% coverage: 3:288/303 of query aligns to 2:287/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
29% identity, 94% coverage: 3:288/303 of query aligns to 2:287/291 of 3pueB
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
29% identity, 94% coverage: 3:286/303 of query aligns to 3:289/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 94% coverage: 3:286/303 of query aligns to 2:288/294 of Q9X1K9
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 89% coverage: 3:271/303 of query aligns to 2:270/292 of Q07607
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
27% identity, 93% coverage: 6:286/303 of query aligns to 10:291/307 of 4fhaA
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
30% identity, 89% coverage: 3:271/303 of query aligns to 2:271/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
29% identity, 80% coverage: 3:244/303 of query aligns to 2:244/294 of Q8UGL3
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 91% coverage: 3:279/303 of query aligns to 3:285/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 91% coverage: 3:279/303 of query aligns to 3:285/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 91% coverage: 3:279/303 of query aligns to 3:285/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 91% coverage: 3:279/303 of query aligns to 3:285/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 91% coverage: 3:279/303 of query aligns to 3:285/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
28% identity, 91% coverage: 3:279/303 of query aligns to 3:285/298 of 3nevA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
29% identity, 86% coverage: 11:271/303 of query aligns to 10:270/292 of 3s8hA
Sites not aligning to the query:
>AO356_09275 FitnessBrowser__pseudo5_N2C3_1:AO356_09275
LKFEGIYTPAVTPHTPDGEIDWRVFSEVLESLIEAKVHGIIIGGSTGEYYAQTAEERLKL
AAHAREVIGSRVQLIIGTGAIRTEDAVLFAEDAKRIKADAILVTTPPYALPTDQENAIHA
LTIDRAANMPIMLYNYPGRMCVQMNEEYLARVGKSKNVKAIKESSGDMGRVHLLAREFPH
IALSCGWDDQALEFFAWGARSWVCAGSNFLPKEHVALYEACVVEKNFDKGRQIMSAMMPL
MNALDGGKFVQCIKFGCELNGLAVGDVRAPLRPLNSDDKRSLQTVIANVKRTVAHITSGA
NNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory