Comparing AO356_09900 FitnessBrowser__pseudo5_N2C3_1:AO356_09900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
43% identity, 89% coverage: 24:246/251 of query aligns to 1:225/225 of 3tqlA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
39% identity, 96% coverage: 12:251/251 of query aligns to 7:258/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
40% identity, 90% coverage: 27:251/251 of query aligns to 3:233/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
40% identity, 90% coverage: 27:251/251 of query aligns to 6:236/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
40% identity, 90% coverage: 27:251/251 of query aligns to 6:236/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
40% identity, 90% coverage: 27:251/251 of query aligns to 6:236/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
40% identity, 90% coverage: 27:251/251 of query aligns to 6:236/238 of 1lafE
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
40% identity, 90% coverage: 26:251/251 of query aligns to 27:258/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
40% identity, 90% coverage: 26:251/251 of query aligns to 5:236/238 of 1hslA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
39% identity, 90% coverage: 27:251/251 of query aligns to 28:258/260 of P0AEU0
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
39% identity, 88% coverage: 27:246/251 of query aligns to 6:223/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
39% identity, 88% coverage: 27:246/251 of query aligns to 6:225/226 of 4zv1A
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
34% identity, 90% coverage: 21:246/251 of query aligns to 2:227/228 of 2y7iA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
34% identity, 89% coverage: 24:246/251 of query aligns to 12:230/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
34% identity, 89% coverage: 24:246/251 of query aligns to 16:234/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
34% identity, 89% coverage: 24:246/251 of query aligns to 16:234/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
34% identity, 89% coverage: 24:246/251 of query aligns to 16:234/241 of 3vvdA
3i6vA Crystal structure of a periplasmic his/glu/gln/arg/opine family- binding protein from silicibacter pomeroyi in complex with lysine
34% identity, 88% coverage: 27:246/251 of query aligns to 2:211/218 of 3i6vA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
31% identity, 90% coverage: 25:249/251 of query aligns to 8:264/267 of 8hqrA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
36% identity, 90% coverage: 22:246/251 of query aligns to 7:228/229 of 5t0wA
>AO356_09900 FitnessBrowser__pseudo5_N2C3_1:AO356_09900
MQTYKKFLLAAAVSLVFSANAMAADKLKMGIEAAYPPFNNKDASGQVVGFDKDIGDALCA
KMKVECEVVTSDWDGIIPALNAKKFDFLISSLSITEERKQAVDFTDPYYSNKLQFIAPKS
AEFKTDKDSLKGKVIGAQRATLAGTWLEDELGSDITTKLYDTQENAYLDLTSGRVDAILA
DKYVNYDWLKTEAGRAYEFKGDPVVESDKIGIAVRKGDNELRNKLNAALKEIVADGTYKK
INDKYFPFNIY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory