SitesBLAST
Comparing AO356_10230 FitnessBrowser__pseudo5_N2C3_1:AO356_10230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4d9fA D-cysteine desulfhydrase from salmonella typhimurium complexed with d- cycloserine (dcs) (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 1:325/328 of 4d9fA
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), G194 (= G195), S195 (= S196), A196 (= A197), T198 (= T199), Y287 (= Y290), T315 (= T317), G316 (= G318), G317 (= G319)
4d9eA D-cysteine desulfhydrase from salmonella typhimurium complexed with l- cycloserine (lcs) (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 1:325/328 of 4d9eA
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: N50 (= N50), K51 (= K51), N79 (= N79), G194 (= G195), S195 (= S196), A196 (= A197), T198 (= T199), Y287 (= Y290), T315 (= T317), G316 (= G318), G317 (= G319)
4d9bA Pyridoxamine 5' phosphate (pmp) bound form of salmonella typhimurium d-cysteine desulfhydrase obtained after co-crystallization with d- cycloserine (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 1:325/328 of 4d9bA
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), N79 (= N79), G194 (= G195), S195 (= S196), A196 (= A197), T198 (= T199), Y287 (= Y290), T315 (= T317), G316 (= G318), G317 (= G319)
4d99A Salmonella typhimurium d-cysteine desulfhydrase with l-ser bound non- covalently at the active site (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 1:325/328 of 4d99A
4d97A Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 1:325/328 of 4d97A
4d96A D-cysteine desulfhydrase from salmonella typhimurium complexed with 1- amino-1-carboxycyclopropane (acc) (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 1:325/328 of 4d96A
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: N50 (= N50), K51 (= K51), S78 (= S78), N79 (= N79), H80 (= H80), G194 (= G195), S195 (= S196), A196 (= A197), T198 (= T199), Y287 (= Y290), T315 (= T317), G316 (= G318), G317 (= G319)
4d8wA Salmonella typhimurium d-cysteine desulfhydrase soaked with d-cys shows pyruvate bound 4 a away from active site (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 1:325/328 of 4d8wA
4d8uH Crystal structure of d-cysteine desulfhydrase from salmonella typhimurium at 3.3 a in monoclinic space group with 8 subunits in the asymmetric unit (see paper)
62% identity, 99% coverage: 1:327/330 of query aligns to 4:328/331 of 4d8uH
1tzmA Crystal structure of acc deaminase complexed with substrate analog b- chloro-d-alanine (see paper)
39% identity, 98% coverage: 6:330/330 of query aligns to 3:328/331 of 1tzmA
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding 3-chloro-D-alanine: G74 (= G74), S78 (= S78), N79 (= N79), Q80 (≠ H80), W102 (≠ P102), A153 (≠ I158), G154 (= G159), Y287 (= Y290)
- binding amino-acrylate: K51 (= K51), S78 (= S78), Q80 (≠ H80), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (≠ A193), S190 (= S194), V191 (≠ G195), T192 (≠ S196), G193 (≠ A197), T195 (= T199), Y287 (= Y290), E288 (≠ T291), L315 (≠ T317), G316 (= G318), G317 (= G319)
1tzkA Crystal structure of 1-aminocyclopropane-1-carboxylate-deaminase complexed with alpha-keto-butyrate (see paper)
39% identity, 98% coverage: 6:330/330 of query aligns to 3:328/331 of 1tzkA
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding 2-ketobutyric acid: K51 (= K51), G74 (= G74), S78 (= S78), N79 (= N79), Q80 (≠ H80), A153 (≠ I158), G154 (= G159), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (≠ A193), S190 (= S194), V191 (≠ G195), T192 (≠ S196), G193 (≠ A197), T195 (= T199), Y287 (= Y290), E288 (≠ T291), L315 (≠ T317), G316 (= G318), G317 (= G319)
1tzjA Crystal structure of 1-aminocyclopropane-1-carboxylate deaminase complexed with d-vinyl glycine (see paper)
39% identity, 98% coverage: 6:330/330 of query aligns to 3:328/331 of 1tzjA
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding d-vinylglycine: G74 (= G74), S78 (= S78), N79 (= N79), Q80 (≠ H80), A153 (≠ I158), G154 (= G159), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (≠ A193), S190 (= S194), V191 (≠ G195), T192 (≠ S196), G193 (≠ A197), T195 (= T199), Y287 (= Y290), E288 (≠ T291), L315 (≠ T317), G316 (= G318), G317 (= G319)
1tz2A Crystal structure of 1-aminocyclopropane-1-carboyxlate deaminase complexed with acc (see paper)
39% identity, 98% coverage: 6:330/330 of query aligns to 3:328/331 of 1tz2A
- active site: K51 (= K51), Y261 (= Y264), Y287 (= Y290)
- binding 1-aminocyclopropanecarboxylic acid: K51 (= K51), S78 (= S78), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (≠ A193), S190 (= S194), V191 (≠ G195), T192 (≠ S196), G193 (≠ A197), T195 (= T199), Y287 (= Y290), E288 (≠ T291), L315 (≠ T317), G316 (= G318), G317 (= G319)
Q5PWZ8 1-aminocyclopropane-1-carboxylate deaminase; ACC deaminase; ACCD; EC 3.5.99.7 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
39% identity, 99% coverage: 5:330/330 of query aligns to 2:335/338 of Q5PWZ8
- G44 (vs. gap) mutation to D: Loss of activity.
1rqxC Crystal structure of acc deaminase complexed with inhibitor (see paper)
39% identity, 98% coverage: 6:330/330 of query aligns to 3:335/338 of 1rqxC
- active site: K51 (= K51), Y268 (= Y264), Y294 (= Y290)
- binding 1-aminocyclopropylphosphonate: K51 (= K51), S78 (= S78), N79 (= N79), Q80 (≠ H80), T199 (≠ S196), Y294 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), S197 (= S194), V198 (≠ G195), T199 (≠ S196), G200 (≠ A197), T202 (= T199), Y294 (= Y290), E295 (≠ T291), L322 (≠ T317), G323 (= G318), G324 (= G319)
1j0bA Crystal structure analysis of the acc deaminase homologue complexed with inhibitor (see paper)
39% identity, 97% coverage: 6:326/330 of query aligns to 9:317/325 of 1j0bA
- active site: K54 (= K51), Y256 (= Y264), Y282 (= Y290)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: N53 (= N50), K54 (= K51), S81 (= S78), N82 (= N79), H83 (= H80), A189 (≠ S194), G190 (= G195), S191 (= S196), G192 (≠ A197), G193 (= G198), T194 (= T199), Y282 (= Y290), T308 (= T317), G309 (= G318), G310 (= G319)
1j0aA Crystal structure analysis of the acc deaminase homologue (see paper)
39% identity, 97% coverage: 6:326/330 of query aligns to 9:317/325 of 1j0aA
- active site: K54 (= K51), Y256 (= Y264), Y282 (= Y290)
- binding pyridoxal-5'-phosphate: N53 (= N50), K54 (= K51), K57 (= K54), N82 (= N79), G190 (= G195), S191 (= S196), G192 (≠ A197), G193 (= G198), T194 (= T199), Y282 (= Y290), T308 (= T317), G309 (= G318), G310 (= G319)
Q7M523 1-aminocyclopropane-1-carboxylate deaminase; ACC deaminase; ACCD; EC 3.5.99.7 from Cyberlindnera saturnus (Yeast) (Williopsis saturnus) (see paper)
37% identity, 98% coverage: 6:330/330 of query aligns to 3:336/341 of Q7M523
Sites not aligning to the query:
- 1 modified: N-acetylserine
1f2dA 1-aminocyclopropane-1-carboxylate deaminase (see paper)
37% identity, 98% coverage: 6:330/330 of query aligns to 3:336/341 of 1f2dA
- active site: K51 (= K51), Y269 (= Y264), Y295 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C200 (≠ S194), T202 (≠ S196), G203 (≠ A197), S204 (≠ G198), T205 (= T199), Y295 (= Y290), E296 (≠ T291), L323 (≠ T317), G324 (= G318), G325 (= G319)
1j0eA Acc deaminase mutant reacton intermediate (see paper)
37% identity, 98% coverage: 6:330/330 of query aligns to 3:336/341 of 1j0eA
- binding 1-aminocyclopropanecarboxylic acid: S78 (= S78), N79 (= N79), Q80 (≠ H80), F295 (≠ Y290)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C199 (≠ A193), T202 (≠ S196), G203 (≠ A197), T205 (= T199), F295 (≠ Y290), E296 (≠ T291)
1j0dA Acc deaminase mutant complexed with acc (see paper)
37% identity, 98% coverage: 6:330/330 of query aligns to 3:336/341 of 1j0dA
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: S78 (= S78), N79 (= N79), Q80 (≠ H80), A163 (≠ I158), G164 (= G159), C200 (≠ S194), V201 (≠ G195), T202 (≠ S196), G203 (≠ A197), S204 (≠ G198), T205 (= T199), Y295 (= Y290), E296 (≠ T291)
Query Sequence
>AO356_10230 FitnessBrowser__pseudo5_N2C3_1:AO356_10230
MIKEQLSRFNRLDLLSHPTPLEKLDRLSNWLGRDIYIKRDDLTPLALGGNKLRKLEYLAA
DAIAQGADTLITAGAIQSNHVRQTAALAAKLGLGCVALLENPIGTEDSNYLGNGNRLLLE
LFDAKVELVENLDNADEQLQALAGRLRSNGKKPYLVPIGGSNALGALGYVRAGLELAEQI
KDTGIEFAAVVLASGSAGTHSGLALALSESLPALPVIGVTVSRSEEDQFPKVQGLAERTA
ALLEVALPEAFKVILWDEYFAPRYGEPNAGTLAAVKLLASLEGLLLDPVYTGKAVAGLLD
GIGRDRFDEGPIIFLHTGGAPALFAYNTVF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory