Comparing AO356_10270 FitnessBrowser__pseudo5_N2C3_1:AO356_10270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4yahX Crystal structure of the methionine binding protein, metq (see paper)
40% identity, 80% coverage: 52:267/269 of query aligns to 28:243/245 of 4yahX
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
37% identity, 84% coverage: 31:257/269 of query aligns to 2:231/241 of 4qhqA
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
37% identity, 86% coverage: 31:260/269 of query aligns to 2:229/235 of 3tqwA
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
38% identity, 74% coverage: 43:240/269 of query aligns to 17:215/242 of 4ntlA
Sites not aligning to the query:
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
37% identity, 75% coverage: 52:254/269 of query aligns to 57:260/272 of P04846
Sites not aligning to the query:
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
37% identity, 75% coverage: 52:254/269 of query aligns to 31:232/237 of 3k2dA
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
37% identity, 63% coverage: 37:206/269 of query aligns to 11:177/247 of 4ib2A
Sites not aligning to the query:
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
41% identity, 54% coverage: 49:192/269 of query aligns to 22:166/240 of 6dzxA
Sites not aligning to the query:
3gxaC Crystal structure of gna1946 (see paper)
41% identity, 54% coverage: 49:192/269 of query aligns to 23:167/244 of 3gxaC
Sites not aligning to the query:
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
36% identity, 55% coverage: 43:191/269 of query aligns to 18:166/240 of 1xs5A
Sites not aligning to the query:
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
32% identity, 80% coverage: 52:267/269 of query aligns to 37:260/260 of 6jf1A
Sites not aligning to the query:
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
40% identity, 59% coverage: 33:192/269 of query aligns to 4:164/255 of 1p99A
Sites not aligning to the query:
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
34% identity, 51% coverage: 52:189/269 of query aligns to 28:164/240 of 4oteB
>AO356_10270 FitnessBrowser__pseudo5_N2C3_1:AO356_10270
MTTQLLTLPVKALALALGLFSSALFAADAPLKIGTTAAFAIPLEAAVEEAGKQGLKVELV
EFSDWIAPNVSLASGDIDVNYFQHIPFLENAKAAAGFDLVPFAPGIINNVGLYSKKYKSF
DELPEGASVAIANDPINSGRGLQLLAKAGLISLEPGVGYKATEDDIVANPKKLKILQVEA
VQLVRAYEDADLVQGYPAYIRLAKTFDASSALLFDGLDHKEYVIQFVIQPKSQNDPRLIK
FVDIYQHSPVVRAALDKAHGKLYQAGWEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory