Comparing AO356_10275 FitnessBrowser__pseudo5_N2C3_1:AO356_10275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
46% identity, 91% coverage: 32:373/374 of query aligns to 2:343/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
45% identity, 91% coverage: 32:373/374 of query aligns to 3:344/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
45% identity, 91% coverage: 32:373/374 of query aligns to 3:344/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
45% identity, 91% coverage: 32:373/374 of query aligns to 3:344/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
49% identity, 62% coverage: 46:276/374 of query aligns to 13:241/241 of 4u00A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
44% identity, 61% coverage: 46:274/374 of query aligns to 12:239/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
44% identity, 61% coverage: 44:272/374 of query aligns to 12:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
44% identity, 61% coverage: 44:272/374 of query aligns to 12:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
44% identity, 61% coverage: 44:272/374 of query aligns to 12:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
44% identity, 61% coverage: 44:272/374 of query aligns to 12:239/242 of 2oljA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 60% coverage: 46:271/374 of query aligns to 37:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 60% coverage: 46:271/374 of query aligns to 37:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 60% coverage: 46:268/374 of query aligns to 37:260/260 of 7ahdC
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
42% identity, 59% coverage: 32:250/374 of query aligns to 2:216/222 of 8i6rB
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 58% coverage: 32:249/374 of query aligns to 2:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 58% coverage: 32:249/374 of query aligns to 2:223/230 of 1l2tA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
43% identity, 58% coverage: 39:256/374 of query aligns to 10:226/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
43% identity, 58% coverage: 39:256/374 of query aligns to 9:225/229 of A5U7B7
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 63% coverage: 28:263/374 of query aligns to 5:245/258 of P02915
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
43% identity, 57% coverage: 39:250/374 of query aligns to 10:218/225 of 8iddA
>AO356_10275 FitnessBrowser__pseudo5_N2C3_1:AO356_10275
MNAVNARLRDEAPAPQSADQTELHPELNRAHVRFIGLGKTYNGSQGPVAALQGIDLAIQR
GEVFGIIGRSGAGKSSLIRTINRLEQPTSGRVLIDRVDIGEFDEDHLVALRRRIGMIFQH
FNLMSAKTVWQNVELPLKVAGVPKEQRQRKVRELLELVGLHGKHKAYPAQLSGGQKQRVG
IARALVHDPQILLCDEATSALDPETTQSILGLLREINQRLGLTIVLITHEMAVIREVCDR
VVVLEQGRIVEQGPVWEVFGNPQHEVSRTLLAPLQHAIPEELQSRLQALPASADAATVLR
LQFTGIDREEPDLAALFSALGGRVRLLHGGIERIQGHGLGQLLLAVSGSSWGAEELRQRA
GNWAQRVEVLGYVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory