Comparing AO356_12720 FitnessBrowser__pseudo5_N2C3_1:AO356_12720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
3vayA Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. Tomato dc3000 (see paper)
69% identity, 97% coverage: 3:230/234 of query aligns to 2:229/230 of 3vayA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
35% identity, 59% coverage: 92:229/234 of query aligns to 71:212/215 of 4ygrA
Sites not aligning to the query:
3i76B The crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
34% identity, 65% coverage: 77:227/234 of query aligns to 74:226/229 of 3i76B
Sites not aligning to the query:
3qnmA Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
26% identity, 95% coverage: 6:227/234 of query aligns to 6:230/231 of 3qnmA
6z1kA A de novo enzyme for the morita-baylis-hillman reaction bh32.6 (see paper)
27% identity, 53% coverage: 106:229/234 of query aligns to 100:231/231 of 6z1kA
Sites not aligning to the query:
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
30% identity, 43% coverage: 106:205/234 of query aligns to 100:204/230 of 6q7nA
Sites not aligning to the query:
4ffdA Crystal structure of engineered protein. Northeast structural genomics consortium target or48
30% identity, 43% coverage: 106:205/234 of query aligns to 100:204/230 of 4ffdA
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
29% identity, 57% coverage: 96:228/234 of query aligns to 86:224/226 of 2no5B
Sites not aligning to the query:
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
29% identity, 57% coverage: 96:228/234 of query aligns to 86:224/231 of Q51645
Sites not aligning to the query:
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
24% identity, 95% coverage: 6:227/234 of query aligns to 4:232/241 of 4knvA
>AO356_12720 FitnessBrowser__pseudo5_N2C3_1:AO356_12720
MTIELITFDLDDTLWDTAPVIASAEAILRQWLSDNAPNLGGLPVEHLFSIREQVLREEPN
LKHRISALRRRVLFRALQEAGYDQWHASELADQAFETFLHARHQLEIFPEVQPTLEILAN
HFALGVVTNGNADVRRLGLADYFKFALCAEDIGIAKPDARLFHEALQRGGATAQTAVHVG
DHPGDDIAGAQQAGLRAVWFNPAGKPWNADHAPDAEIRSLTELPGLLAGWHSQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory