Comparing AO356_13080 FitnessBrowser__pseudo5_N2C3_1:AO356_13080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
50% identity, 98% coverage: 3:378/385 of query aligns to 2:378/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
30% identity, 86% coverage: 45:374/385 of query aligns to 43:362/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
30% identity, 86% coverage: 45:374/385 of query aligns to 44:357/360 of 2f7vA
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 89% coverage: 37:378/385 of query aligns to 30:382/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
24% identity, 88% coverage: 36:374/385 of query aligns to 28:371/377 of 7t1qA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
24% identity, 89% coverage: 22:363/385 of query aligns to 14:360/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
24% identity, 89% coverage: 22:363/385 of query aligns to 14:360/375 of 4pqaA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
25% identity, 74% coverage: 5:288/385 of query aligns to 4:286/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 72% coverage: 13:288/385 of query aligns to 12:282/377 of P44514
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
23% identity, 94% coverage: 14:374/385 of query aligns to 3:372/377 of 7lgpB
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
23% identity, 79% coverage: 43:345/385 of query aligns to 44:364/408 of Q03154
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
29% identity, 88% coverage: 33:371/385 of query aligns to 23:331/341 of 5xoyA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 55% coverage: 56:268/385 of query aligns to 82:301/426 of 3pfoA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
24% identity, 61% coverage: 32:266/385 of query aligns to 33:281/407 of P37111
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
30% identity, 36% coverage: 5:143/385 of query aligns to 2:139/258 of 4h2kA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
23% identity, 72% coverage: 71:346/385 of query aligns to 72:340/373 of 3rzaA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
37% identity, 28% coverage: 35:141/385 of query aligns to 27:135/265 of 4op4B
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
47% identity, 16% coverage: 60:120/385 of query aligns to 114:177/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
47% identity, 16% coverage: 60:120/385 of query aligns to 83:146/471 of 3dljA
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
26% identity, 62% coverage: 22:260/385 of query aligns to 55:288/415 of P06621
Sites not aligning to the query:
>AO356_13080 FitnessBrowser__pseudo5_N2C3_1:AO356_13080
MPLPSMKDQFAALIATPSVSCTQPGLDQSNSAVIELLAGWLTELGFSCDVQQVSPGKFNL
LASFGSGPGGLVLAGHSDTVPFDGALWQTDPLKLTEVDGRWVGLGSCDMKGFFALAIEAV
KPLLDQPFKQPLLILATCDEESSMAGARALADAGRPLGRAAVIGEPTGLRPIRLHKGVMM
ERIDILGRSGHSSDPSLGRSALEAMHDAMGELRGLRLQWQREFRNPQFSVPQPTLNFGCI
HGGDNPNRICGQCSMEFDLRPLPGMDPQVLRAAIRQKLEPIAERHQVKIDYAPLFPEVPP
FEQAEDAELVRVAERLTGHRAEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLEM
SRLQPTVQLLRQLIGHYCLTPATAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory