Comparing AO356_13955 FitnessBrowser__pseudo5_N2C3_1:AO356_13955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
88% identity, 100% coverage: 1:345/346 of query aligns to 1:345/346 of O50584
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
85% identity, 99% coverage: 3:345/346 of query aligns to 1:343/344 of 5vyeB
1v72A Crystal structure of phenylserine aldolase from pseudomonas putida
46% identity, 97% coverage: 8:341/346 of query aligns to 7:342/345 of 1v72A
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
27% identity, 87% coverage: 35:336/346 of query aligns to 32:328/338 of O07051
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
29% identity, 80% coverage: 35:311/346 of query aligns to 30:298/324 of 3wgbD
Sites not aligning to the query:
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
28% identity, 80% coverage: 35:311/346 of query aligns to 31:305/333 of 3wgcB
Sites not aligning to the query:
1jg8D Crystal structure of threonine aldolase (low-specificity)
28% identity, 51% coverage: 10:187/346 of query aligns to 7:182/344 of 1jg8D
Sites not aligning to the query:
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
28% identity, 51% coverage: 10:187/346 of query aligns to 6:181/343 of 1lw5B
Sites not aligning to the query:
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
28% identity, 51% coverage: 10:187/346 of query aligns to 6:181/343 of 1lw4B
Sites not aligning to the query:
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
26% identity, 78% coverage: 35:304/346 of query aligns to 30:290/331 of 3wlxA
Sites not aligning to the query:
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
25% identity, 90% coverage: 35:345/346 of query aligns to 30:332/332 of 4rjyA
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
25% identity, 90% coverage: 35:345/346 of query aligns to 30:332/332 of 4lnlA
Sites not aligning to the query:
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
25% identity, 90% coverage: 35:345/346 of query aligns to 30:332/332 of 4lnjA
Sites not aligning to the query:
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
25% identity, 89% coverage: 35:341/346 of query aligns to 30:328/331 of 4lnmA
Sites not aligning to the query:
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 73% coverage: 59:310/346 of query aligns to 57:307/358 of Q8RXU4
>AO356_13955 FitnessBrowser__pseudo5_N2C3_1:AO356_13955
MTDKSQQFASDNYSGICPEAWAAMEEANQGHQRAYGDDEWTHRAADDFRALFETDCEVFF
AFNGTAANSLALSSLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLLARTENGKLTPE
AIREIALKRQDIHYPKPRVVTLTQATEVGSVYTPDEIRAISVTCKELGLNLHMDGARFSN
ACAFLGCSPADLTWKVGVDVLCFGGTKNGMAVGEAILFFNHDLAVDFDYRCKQAGQLASK
MRFLSAPWVGLLQNDAWLKHARHANHCAQLLAELVNDIPGVELMFPVQANGVFLQLSEPA
IAALTAKGWRFYTFIGKGGARFMCSWDTEEARVRELAADIREVMSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory