Comparing AO356_14000 AO356_14000 aldehyde dismutase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
95% identity, 100% coverage: 1:399/399 of query aligns to 1:399/399 of P46154
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
95% identity, 99% coverage: 3:398/399 of query aligns to 1:396/396 of 1kolA
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
90% identity, 99% coverage: 3:396/399 of query aligns to 1:394/395 of 4jlwA
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
59% identity, 99% coverage: 1:397/399 of query aligns to 1:397/399 of Q52078
Sites not aligning to the query:
2dphA Crystal structure of formaldehyde dismutase
59% identity, 99% coverage: 2:397/399 of query aligns to 1:396/398 of 2dphA
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
31% identity, 94% coverage: 5:381/399 of query aligns to 2:334/346 of 4cpdA
Sites not aligning to the query:
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
35% identity, 67% coverage: 1:267/399 of query aligns to 2:246/348 of 5ylnA
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
32% identity, 54% coverage: 37:250/399 of query aligns to 28:227/341 of P07913
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
35% identity, 57% coverage: 38:264/399 of query aligns to 28:244/351 of 3fplA
Sites not aligning to the query:
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
35% identity, 57% coverage: 38:264/399 of query aligns to 29:245/344 of 7xy9A
Sites not aligning to the query:
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
33% identity, 52% coverage: 23:231/399 of query aligns to 10:206/339 of 5kiaA
Sites not aligning to the query:
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
35% identity, 57% coverage: 38:264/399 of query aligns to 28:244/352 of 7uutA
Sites not aligning to the query:
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
35% identity, 57% coverage: 38:264/399 of query aligns to 26:242/350 of 7ux4A
Sites not aligning to the query:
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
35% identity, 57% coverage: 38:264/399 of query aligns to 28:244/352 of 1ykfA
Sites not aligning to the query:
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
35% identity, 57% coverage: 38:264/399 of query aligns to 28:244/352 of 1bxzB
Sites not aligning to the query:
P14941 NADP-dependent isopropanol dehydrogenase; EC 1.1.1.80 from Thermoanaerobacter brockii (Thermoanaerobium brockii) (see 2 papers)
35% identity, 57% coverage: 38:264/399 of query aligns to 28:244/352 of P14941
Sites not aligning to the query:
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
27% identity, 90% coverage: 37:394/399 of query aligns to 30:347/347 of 3gfbA
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
31% identity, 62% coverage: 15:263/399 of query aligns to 14:260/357 of 7y9pA
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
35% identity, 49% coverage: 37:231/399 of query aligns to 32:212/350 of Q5JI69
Sites not aligning to the query:
7f3pD Crystal structure of a NADP-dependent alcohol dehydrogenase mutant in apo form (see paper)
35% identity, 57% coverage: 38:264/399 of query aligns to 31:247/355 of 7f3pD
>AO356_14000 AO356_14000 aldehyde dismutase
MSGNRGVVYLGNGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNPVRLAHAKAQGFEIADLSTD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHDGVKHEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRALMQAIMWDRINIA
EIVGVQVISLDDAPKGYGEFDAGVPKKFVIDPHKLFSAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory