Comparing AO356_14490 FitnessBrowser__pseudo5_N2C3_1:AO356_14490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
41% identity, 100% coverage: 2:344/344 of query aligns to 5:347/347 of 2i3gA
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
41% identity, 100% coverage: 2:344/344 of query aligns to 2:344/344 of 7npjB
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
41% identity, 100% coverage: 2:344/344 of query aligns to 2:344/344 of 7nphC
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
41% identity, 100% coverage: 2:344/344 of query aligns to 2:344/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
41% identity, 100% coverage: 2:344/344 of query aligns to 2:344/344 of 7nnrA
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
38% identity, 99% coverage: 4:344/344 of query aligns to 6:344/344 of O50146
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
38% identity, 99% coverage: 4:344/344 of query aligns to 4:342/342 of 2ozpA
5einA Crystal structure of c148a mutant of lysy from thermus thermophilus in complex with NADP+ and lysw-gamma-aminoadipic acid (see paper)
38% identity, 99% coverage: 4:344/344 of query aligns to 6:344/344 of 5einA
4dpmA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with coa (see paper)
21% identity, 74% coverage: 2:254/344 of query aligns to 3:255/354 of 4dpmA
Sites not aligning to the query:
4dplA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with NADP (see paper)
21% identity, 74% coverage: 2:254/344 of query aligns to 3:255/354 of 4dplA
Sites not aligning to the query:
4dpkA Structure of malonyl-coenzyme a reductase from crenarchaeota (see paper)
21% identity, 74% coverage: 2:254/344 of query aligns to 3:255/354 of 4dpkA
>AO356_14490 FitnessBrowser__pseudo5_N2C3_1:AO356_14490
MVKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDGLAFSV
PDVKTLGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGA
PELLEEAVYGLPEVNREKIKQARLIAVPGCYPTATQLGFLPLLEAGLADTSRLIADCKSG
VSGAGRGASVGSLYSETSESMKAYAVKGHRHLPEIRQGLRRAAGKDVGLTFVPHLTPMIR
GIHSTLYATVVDRSVDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQD
GDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERLGLSHAGMLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory