Comparing AO356_15130 FitnessBrowser__pseudo5_N2C3_1:AO356_15130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
42% identity, 90% coverage: 1:409/454 of query aligns to 2:415/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
35% identity, 90% coverage: 3:411/454 of query aligns to 7:453/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 85% coverage: 1:385/454 of query aligns to 5:427/514 of Q42598
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
31% identity, 87% coverage: 1:393/454 of query aligns to 5:410/496 of 8g1yA
Sites not aligning to the query:
1vb3A Crystal structure of threonine synthase from escherichia coli
30% identity, 86% coverage: 1:389/454 of query aligns to 1:362/428 of 1vb3A
>AO356_15130 FitnessBrowser__pseudo5_N2C3_1:AO356_15130
MRYVSTRNSAVQVDFEKVVLSAIAEDGGLFVPVELPQFESQDIANWSTLAYDELAYRVMR
PFVGEAIPEADFKRVLKEAGSQFSHRSLAPLHQVDRNEWVLELFHGPTRSSKDFAAQLQA
RLVQYFLRKRGRRAVVIGVTNGDTGLAAIEAFKHCDETDVVVIYPEAGVLQDQLQDLQAT
AHPRVHQVAVDGSFDECQTLVTQLFRQHEAISFNSSNWVSVMAQLVFYFHAVLQLGGGQR
PIGFSVPAASFAEVYAGYIAQKMGLPITQMIVATNQNDALHQFFLKNHYSRLRASKTLSP
AMDLSIFSNLERFLWELYGHDDQAVSALMHTFETRGEMTIANEFWLQARMIIDSYAVSDE
QTLEEITSLYRDTGYVIDPHTATGVLAARLYRRSLVAPMVTLGEISPAKSAQLLGELGIS
IAAQQHPVSEHGPAQIHRIQPDDLAALHQLLGAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory