SitesBLAST
Comparing AO356_15715 FitnessBrowser__pseudo5_N2C3_1:AO356_15715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
27% identity, 93% coverage: 3:407/437 of query aligns to 2:418/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 93% coverage: 3:407/437 of query aligns to 1:417/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L3 (≠ C5), L191 (≠ R188), G195 (≠ M192), R282 (= R279)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A268), S272 (= S269), S273 (= S270), M307 (≠ L303), T310 (≠ F306), G353 (= G349), A354 (≠ S350), R394 (= R384), T395 (≠ A385)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
27% identity, 93% coverage: 3:407/437 of query aligns to 4:420/427 of 5e9sA
- binding aspartic acid: R274 (≠ A268), S275 (= S269), S276 (= S270), T313 (≠ F306), G353 (= G346), V354 (≠ I347), A357 (≠ S350), G358 (≠ A351), D394 (≠ G381), R397 (= R384), T398 (≠ A385)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R188), G198 (≠ M192), Y202 (≠ L196)
- binding sodium ion: Y87 (≠ F81), T90 (≠ L84), S91 (≠ T85), S276 (= S270), G305 (= G298), A306 (≠ Y299), T307 (≠ S300), N309 (= N302), N309 (= N302), M310 (≠ L303), D311 (= D304), S348 (= S341), I349 (≠ K342), G350 (= G343), T351 (≠ A344), N401 (= N388), V402 (≠ L389), D405 (≠ N392)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
27% identity, 93% coverage: 3:407/437 of query aligns to 4:420/426 of 6xwnB
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
27% identity, 93% coverage: 3:407/437 of query aligns to 6:420/425 of O59010
- S65 (≠ V56) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A268) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 268:270) binding
- M311 (≠ L303) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ F306) binding
- V355 (≠ I347) binding
- D394 (≠ G381) binding
- M395 (≠ I382) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R384) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N388) binding
- D405 (≠ N392) mutation to N: Strongly decreased affinity for aspartate.
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 91% coverage: 9:407/437 of query aligns to 3:409/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A268), S265 (= S270), M299 (≠ L303), T302 (≠ F306), T340 (≠ A344), G342 (= G346), V343 (≠ I347), G347 (≠ A351), D383 (≠ G381), R386 (= R384), T387 (≠ A385), N390 (= N388)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E29), V212 (≠ L217), A216 (≠ G221)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 92% coverage: 3:403/437 of query aligns to 6:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y7 (≠ W4), F46 (≠ L37), F46 (≠ L37), P75 (≠ D66), L91 (≠ V83), F95 (≠ I87), L130 (≠ T130), I133 (≠ F133), I159 (≠ V159), Y167 (≠ L167), K196 (≠ R188), G200 (≠ M192), I207 (= I199), F210 (= F202), L250 (≠ V242), I262 (≠ L254), M269 (≠ L261), T334 (≠ A326), V335 (≠ L327), G336 (≠ S328), T340 (= T332), L343 (= L335), M399 (≠ L386)
- binding aspartic acid: S277 (= S269), S278 (= S270), T314 (≠ F306), G354 (= G346), A358 (≠ S350), G359 (≠ A351), D394 (≠ G381), R397 (= R384), T398 (≠ A385)
- binding sodium ion: Y89 (≠ F81), T92 (≠ L84), S93 (≠ T85), G306 (= G298), T308 (≠ S300), N310 (= N302), N310 (= N302), M311 (≠ L303), D312 (= D304), S349 (= S341), I350 (≠ K342), T352 (≠ A344), N401 (= N388), V402 (≠ L389), D405 (≠ N392)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 92% coverage: 3:403/437 of query aligns to 3:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ W4), G66 (= G60), V83 (= V78), I157 (≠ L160), Y164 (≠ L167), K193 (≠ R188), T305 (≠ S300), I306 (≠ F301), I347 (≠ K342)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V13), M199 (≠ V194), S275 (= S270), T311 (≠ F306), G356 (≠ A351), L384 (= L374), D391 (≠ G381), R394 (= R384)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 90% coverage: 12:403/437 of query aligns to 6:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
27% identity, 90% coverage: 12:403/437 of query aligns to 7:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
27% identity, 90% coverage: 12:403/437 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S270), M303 (≠ L303), T306 (≠ F306), A345 (≠ H345), G346 (= G346), V347 (≠ I347), G351 (≠ A351), D386 (≠ G381), C389 (≠ R384), T390 (≠ A385), N393 (= N388)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
26% identity, 90% coverage: 12:403/437 of query aligns to 7:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 86% coverage: 20:394/437 of query aligns to 33:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V70), G89 (= G71), G92 (= G74), A95 (≠ S77), V96 (= V78), Y99 (≠ F81), M163 (≠ V159), F167 (≠ S163), F293 (≠ L293), V297 (≠ T297)
- binding aspartic acid: S268 (= S269), S269 (= S270), T306 (≠ F306), G346 (= G346), I347 (= I347), A350 (≠ S350), G351 (≠ A351), D380 (≠ G381), R383 (= R384), T384 (≠ A385)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 87% coverage: 14:392/437 of query aligns to 16:403/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S269), S281 (= S270), T318 (≠ F306), G363 (≠ A351), M367 (≠ L355), V385 (≠ L374), D388 (= D377), R395 (= R384), T396 (≠ A385)
- binding dodecyl beta-D-glucopyranoside: V16 (= V14), V19 (≠ L17), I20 (≠ M18), W389 (= W378)
- binding cholesterol hemisuccinate: R80 (= R72), R84 (≠ K76), I95 (= I87), I252 (= I238)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
29% identity, 87% coverage: 14:392/437 of query aligns to 8:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ V56), L58 (≠ V57), L65 (≠ A64), V339 (≠ K342), G340 (= G343), S343 (≠ G346), I344 (= I347)
- binding cholesterol: W188 (≠ R195), I227 (vs. gap), F250 (≠ L254), W257 (≠ L261), M379 (≠ G383), S382 (≠ L386)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S270), M300 (≠ L303), T303 (≠ F306), Y306 (= Y309), G348 (≠ A351), L349 (= L352), M352 (≠ L355), I366 (≠ L370), L369 (≠ V373), V370 (≠ L374), D373 (= D377), D377 (≠ G381), R380 (= R384), T381 (≠ A385), N384 (= N388)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
28% identity, 87% coverage: 14:392/437 of query aligns to 15:404/425 of 7xr4A
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
24% identity, 96% coverage: 14:434/437 of query aligns to 51:541/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
26% identity, 87% coverage: 14:392/437 of query aligns to 51:485/573 of P31596
- K298 (≠ S210) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (vs. gap) mutation H->N,T,K,R: No transporter activity.
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 95% coverage: 7:419/437 of query aligns to 47:518/542 of P43003
- S363 (≠ A268) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 268:270) binding
- T396 (≠ S300) binding
- T402 (≠ F306) binding
- IPQAG 443:447 (≠ IPGSA 347:351) binding
- D476 (≠ G381) binding
- R477 (≠ I382) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N388) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 98% coverage: 7:435/437 of query aligns to 47:542/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ D119) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Query Sequence
>AO356_15715 FitnessBrowser__pseudo5_N2C3_1:AO356_15715
MLKWCSRSIFLQVVLGLMLGIVCGLTLPEYSAQLKPLGDGFIKLIKMLIGLIVFCVVVSG
ISGAGDLKKVGRIGLKSVIYFEVLTTIALVIGLVLAFSTGIGSGANIHLEQLSSADVNDI
AQRGQHMVTTTQFLMNLIPTSVIGAFAENNILQVLLFSVLFGSALNLVGDAASGISRLIN
ELSHVIFRIMGMIVRLAPIGVFGAIAFTTSKYGLDSLQHLGSLVGLFYLTCIAFVTLILG
LVMRASGLPMLPFLKYLREELLIVLGTASSDAVLPQIMRKLEHLGIGSSTVGLVIPTGYS
FNLDGFSIYLTLAIVFIANATGTPLALSDLLTILLVSLITSKGAHGIPGSALVILAATLT
AIPAIPVVGLVLVLAVDWFMGIGRALTNLIGNCVATVAIARWEKDIDVPRARKVLSGQQG
YTFQPRKPVGSAHHQQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory