SitesBLAST
Comparing AO356_16715 FitnessBrowser__pseudo5_N2C3_1:AO356_16715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
73% identity, 98% coverage: 1:313/320 of query aligns to 4:317/319 of 5u63B
- active site: C139 (= C136), C142 (= C139), D143 (= D140)
- binding flavin-adenine dinucleotide: G16 (= G13), S17 (= S14), G18 (= G15), P19 (= P16), A20 (= A17), T39 (= T36), G40 (= G37), Q42 (= Q39), G45 (= G42), Q46 (= Q43), L47 (= L44), T50 (= T47), N55 (= N52), H87 (= H84), I88 (= I85), A115 (= A112), T116 (= T113), G117 (= G114), H248 (= H244), G288 (= G284), D289 (= D285), R296 (= R292), Q297 (= Q293), A298 (= A294), S301 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R118), G157 (= G154), H179 (= H176), R180 (= R177), R181 (= R178), I246 (= I242), G247 (= G243), H248 (= H244), R296 (= R292)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
74% identity, 98% coverage: 1:315/320 of query aligns to 3:318/319 of 5vt3B
- active site: C138 (= C136), C141 (= C139), D142 (= D140)
- binding flavin-adenine dinucleotide: G15 (= G13), S16 (= S14), G17 (= G15), P18 (= P16), A19 (= A17), T38 (= T36), G39 (= G37), Q41 (= Q39), G44 (= G42), Q45 (= Q43), L46 (= L44), T49 (= T47), N54 (= N52), H86 (= H84), I87 (= I85), S114 (≠ A112), T115 (= T113), G116 (= G114), E162 (= E160), H247 (= H244), G287 (= G284), D288 (= D285), R295 (= R292), Q296 (= Q293), A297 (= A294), S300 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L120), G156 (= G154), G157 (= G155), N158 (= N156), T159 (= T157), H178 (= H176), R179 (= R177), R180 (= R178), R184 (= R182), I245 (= I242), G246 (= G243), R295 (= R292), Q296 (= Q293)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
71% identity, 100% coverage: 1:319/320 of query aligns to 1:321/321 of P0A9P4
- M1 (= M1) modified: Initiator methionine, Removed
- 36:43 (vs. 36:43, 75% identical) binding
- C136 (= C136) modified: Disulfide link with 139, Redox-active
- C139 (= C139) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 285:294, 80% identical) binding
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
71% identity, 98% coverage: 5:319/320 of query aligns to 4:320/320 of 1f6mA
- active site: S135 (≠ C136), C138 (= C139), D139 (= D140)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L120), G153 (= G154), G154 (= G155), N155 (= N156), T156 (= T157), E159 (= E160), H175 (= H176), R176 (= R177), R177 (= R178), R181 (= R182), I243 (= I242), G244 (= G243), H245 (= H244), R293 (= R292), Q294 (= Q293)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (= T36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (= H84), I84 (= I85), A111 (= A112), T112 (= T113), G113 (= G114), H245 (= H244), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (= S297)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
72% identity, 97% coverage: 5:315/320 of query aligns to 4:316/316 of 1tdfA
- active site: C135 (= C136), S138 (≠ C139), D139 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (= T36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (= H84), I84 (= I85), A111 (= A112), T112 (= T113), S138 (≠ C139), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L120), I151 (≠ V152), T156 (= T157), E159 (= E160), H175 (= H176), R176 (= R177), R181 (= R182), E183 (= E184), I243 (= I242), G244 (= G243), H290 (= H289), R293 (= R292)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
58% identity, 96% coverage: 5:312/320 of query aligns to 5:311/315 of 4jnqA
- active site: C137 (= C136), C140 (= C139), D141 (= D140)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L12), G13 (= G13), S14 (= S14), G15 (= G15), P16 (= P16), A17 (= A17), A36 (≠ T36), G37 (= G37), Q39 (= Q39), G42 (= G42), Q43 (= Q43), L44 (= L44), N52 (= N52), I85 (= I85), A113 (= A112), T114 (= T113), C140 (= C139), G283 (= G284), D284 (= D285), R291 (= R292), Q292 (= Q293), A293 (= A294)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
51% identity, 95% coverage: 9:312/320 of query aligns to 6:303/306 of 5uthA
- active site: C133 (= C136), C136 (= C139), D137 (= D140)
- binding flavin-adenine dinucleotide: I9 (≠ L12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), F32 (≠ I35), E33 (≠ T36), G34 (= G37), Q36 (= Q39), G39 (= G42), A40 (≠ Q43), L41 (= L44), N49 (= N52), D81 (≠ H84), V82 (≠ I85), M110 (≠ T113), G111 (= G114), C136 (= C139), G275 (= G284), D276 (= D285), R283 (= R292), Q284 (= Q293), A285 (= A294), A288 (≠ S297)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
51% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R118), H115 (≠ Y119), L116 (= L120), R173 (= R177), E200 (≠ T207), I201 (≠ L208), I235 (= I242)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
51% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L120), R173 (= R177), E200 (≠ T207), I201 (≠ L208)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
51% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R118), H115 (≠ Y119), L116 (= L120), V148 (= V152), R173 (= R177), E200 (≠ T207), I201 (≠ L208)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
51% identity, 95% coverage: 9:312/320 of query aligns to 5:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H84), V81 (≠ I85), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G154), G151 (= G155), D152 (≠ N156), S153 (≠ T157), E156 (= E160), H172 (= H176), R173 (= R177), R174 (= R178), R178 (= R182), I235 (= I242)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
48% identity, 95% coverage: 9:312/320 of query aligns to 17:315/335 of P9WHH1
- SGPA 22:25 (= SGPA 14:17) binding
- Y32 (= Y24) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 36:43, 38% identical) binding
- N60 (= N52) binding
- V93 (≠ I85) binding
- C145 (= C136) modified: Disulfide link with 148, Redox-active
- C148 (= C139) modified: Disulfide link with 145, Redox-active
- S166 (≠ T157) binding
- H185 (= H176) binding
- R191 (= R182) binding
- I248 (= I242) binding
- Y268 (= Y261) binding
- D288 (= D285) binding
- R295 (= R292) binding
- RQAV 295:298 (≠ RQAI 292:295) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
48% identity, 95% coverage: 9:312/320 of query aligns to 8:306/313 of 2a87A
- active site: F39 (≠ A40), L43 (= L44), D48 (≠ E49), C136 (= C136), C139 (= C139), D140 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), F34 (≠ I35), E35 (≠ T36), G36 (= G37), G40 (= G41), G41 (= G42), A42 (≠ Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), D83 (≠ H84), V84 (≠ I85), M113 (≠ T113), C139 (= C139), G278 (= G284), D279 (= D285), R286 (= R292), Q287 (= Q293), A288 (= A294), V289 (≠ I295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L120), G155 (= G155), D156 (≠ N156), S157 (≠ T157), H176 (= H176), R177 (= R177), R178 (= R178), R182 (= R182), I239 (= I242), Y259 (= Y261), R283 (≠ H289), R286 (= R292)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
46% identity, 96% coverage: 6:312/320 of query aligns to 2:319/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (≠ I35), E32 (≠ T36), G33 (= G37), A36 (vs. gap), T38 (vs. gap), A39 (≠ Q39), G42 (= G42), Q43 (= Q43), L44 (= L44), T47 (= T47), I50 (≠ V50), N52 (= N52), T84 (≠ H84), I85 (= I85), T120 (= T113), G121 (= G114), C146 (= C139), G291 (= G284), D292 (= D285), R299 (= R292), Q300 (= Q293), A301 (= A294), S304 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G154), G164 (= G155), S166 (≠ T157), R186 (= R177), R187 (= R178), R191 (= R182), V252 (≠ I242)
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
46% identity, 97% coverage: 6:316/320 of query aligns to 2:318/318 of 3d8xA
- active site: C141 (= C136), C144 (= C139), D145 (= D140)
- binding flavin-adenine dinucleotide: I8 (≠ L12), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (≠ I35), G33 (= G37), A36 (= A40), I39 (vs. gap), G43 (= G42), Q44 (= Q43), I51 (≠ V50), N53 (= N52), T85 (≠ H84), V86 (≠ I85), T118 (= T113), G119 (= G114), C144 (= C139), G286 (= G284), D287 (= D285), R294 (= R292), Q295 (= Q293), A296 (= A294), S299 (= S297)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L120), G160 (= G153), S164 (≠ T157), R184 (= R177), K185 (≠ R178), R189 (= R182), I247 (= I242)
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
46% identity, 97% coverage: 6:316/320 of query aligns to 3:319/319 of P29509
- SGPA 11:14 (= SGPA 14:17) binding
- IA 40:41 (vs. gap) binding
- Q45 (= Q43) binding
- N54 (= N52) binding
- V87 (≠ I85) binding
- C142 (= C136) modified: Disulfide link with 145, Redox-active
- C145 (= C139) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D285) binding
- RQA 295:297 (= RQA 292:294) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
46% identity, 97% coverage: 6:316/320 of query aligns to 3:319/319 of 3itjB
- active site: C142 (= C136), C145 (= C139), D146 (= D140)
- binding flavin-adenine dinucleotide: I9 (≠ L12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), Y32 (≠ I35), E33 (≠ T36), G34 (= G37), A37 (= A40), I40 (vs. gap), A41 (vs. gap), G44 (= G42), Q45 (= Q43), T49 (= T47), I52 (≠ V50), N54 (= N52), T86 (≠ H84), V87 (≠ I85), T119 (= T113), G120 (= G114), W135 (≠ M129), C145 (= C139), G287 (= G284), D288 (= D285), R295 (= R292), Q296 (= Q293), A297 (= A294), S300 (= S297)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
45% identity, 95% coverage: 9:312/320 of query aligns to 72:377/515 of Q70G58
- C203 (= C136) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C139) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A158) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H176) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R177) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
46% identity, 95% coverage: 9:312/320 of query aligns to 4:304/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G13), S9 (= S14), G10 (= G15), P11 (= P16), A12 (= A17), E31 (≠ T36), G32 (= G37), N35 (vs. gap), G36 (vs. gap), G39 (= G42), Q40 (= Q43), L41 (= L44), T44 (= T47), N49 (= N52), D81 (≠ H84), V82 (≠ I85), A109 (= A112), T110 (= T113), W126 (≠ M129), S136 (≠ C139), G276 (= G284), D277 (= D285), R284 (= R292), Q285 (= Q293), A286 (= A294), A289 (≠ S297)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
45% identity, 98% coverage: 1:312/320 of query aligns to 12:330/356 of 5w4cA
- binding calcium ion: E99 (≠ D83), E116 (≠ D100), E118 (≠ A102)
- binding flavin-adenine dinucleotide: I23 (≠ L12), G24 (= G13), S25 (= S14), P27 (= P16), G28 (≠ A17), Y46 (≠ I35), G48 (= G37), A51 (= A40), F54 (vs. gap), G58 (= G42), Q59 (= Q43), L60 (= L44), T63 (= T47), N68 (= N52), V101 (≠ I85), T134 (= T113), G135 (= G114), G302 (= G284), D303 (= D285), R310 (= R292), Q311 (= Q293), A312 (= A294), S315 (= S297)
Sites not aligning to the query:
Query Sequence
>AO356_16715 FitnessBrowser__pseudo5_N2C3_1:AO356_16715
MSEVRHSRVIILGSGPAGYSAAVYAARANLKPLLITGMQAGGQLTTTTEVDNWPGDVHGL
TGPALMERMKEHAERFETEIVFDHINAVDFAAKPYTLTGDSATYTCDALIIATGASARYL
GLPSEEAFMGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALYLANIASTVTLIHRRET
FRAEKILIDKLNARVAEGKIILKLNATLDEVLGDNMGVTGARLKNNDGSFDEIKVDGVFI
AIGHTPNTSLFEGQLELKDGYLVVKGGRDGNATATSVEGIFAAGDVADHVYRQAITSAGA
GCMAALDTERYLDGLQNASF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory