SitesBLAST
Comparing AO356_16745 FitnessBrowser__pseudo5_N2C3_1:AO356_16745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
28% identity, 98% coverage: 4:235/236 of query aligns to 6:242/250 of 5bt9C
- active site: R18 (= R16), I140 (= I133), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R16), I19 (≠ V17), C38 (≠ T35), N39 (≠ Y36), R40 (= R37), S41 (≠ T38), L66 (≠ F58), E67 (= E61), N90 (= N84), S92 (= S86), I140 (= I133), K159 (= K152), P184 (= P177), G185 (≠ A178), T187 (≠ L180), L188 (= L181)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
29% identity, 96% coverage: 9:234/236 of query aligns to 10:239/241 of 5t2uA
- active site: G17 (≠ R16), T135 (≠ D135), T145 (≠ H145), Y148 (= Y148), K152 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), G17 (≠ R16), R38 (= R37), D39 (≠ T38), R42 (≠ P41), D60 (≠ E61), L61 (≠ T62), N83 (= N84), A84 (= A85), Y87 (≠ W88), I133 (= I133), T135 (≠ D135), Y148 (= Y148), K152 (= K152), P178 (= P177), P180 (≠ L179), T181 (≠ L180), T183 (vs. gap), T185 (vs. gap), T186 (vs. gap)
3bmoA Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor (compound ax4) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:249/255 of 3bmoA
- active site: R13 (= R16), D148 (= D135), Y161 (= Y148), K165 (= K152)
- binding 6-[(4-methylphenyl)sulfanyl]pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), Y161 (= Y148), L196 (≠ F182), P197 (vs. gap), W208 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L146 (≠ I133), K165 (= K152), P191 (= P177), G192 (≠ A178), V193 (≠ L179), S194 (≠ L180)
2c7vC Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate (see paper)
26% identity, 95% coverage: 9:232/236 of query aligns to 6:254/260 of 2c7vC
- active site: R13 (= R16), D153 (= D135), Y166 (= Y148), K170 (= K152)
- binding methotrexate: R13 (= R16), S94 (= S86), F96 (≠ W88), P98 (vs. gap), Y166 (= Y148), P202 (vs. gap), M205 (vs. gap), W213 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H32 (≠ T35), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T118 (≠ V106), L151 (≠ I133), C152 (≠ S134), K170 (= K152), P196 (= P177), S199 (≠ L180)
6geyA Trypanosoma brucei ptr1 in complex with inhibitor 4g (f125) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 7:246/252 of 6geyA
- active site: R14 (= R16), D145 (= D135), Y158 (= Y148), K162 (= K152)
- binding 2-azanyl-~{N}-[(3,4-dichlorophenyl)methyl]-1,3-benzothiazole-6-carboxamide: S95 (= S86), F97 (≠ W88), C152 (≠ S142), Y158 (= Y148), P194 (vs. gap), M197 (vs. gap), W205 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R14 (= R16), I15 (≠ V17), H33 (≠ T35), Y34 (= Y36), H35 (≠ R37), N36 (≠ T38), S37 (≠ E39), D62 (= D57), L63 (≠ F58), N93 (= N84), A94 (= A85), S95 (= S86), T118 (≠ V106), L143 (≠ I133), D145 (= D135), K162 (= K152), P188 (= P177), G189 (≠ A178), S191 (≠ L180), L192 (= L181)
6gdpA Trypanosoma brucei ptr1 in complex with inhibitor 4l (f162) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 7:246/252 of 6gdpA
- active site: R14 (= R16), D145 (= D135), Y158 (= Y148), K162 (= K152)
- binding 2-azanyl-~{N}-(diphenylmethyl)-1,3-benzothiazole-6-carboxamide: S95 (= S86), F97 (≠ W88), M147 (≠ V137), C152 (≠ S142), Y158 (= Y148), V190 (≠ L179), W205 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R14 (= R16), I15 (≠ V17), Y34 (= Y36), H35 (≠ R37), N36 (≠ T38), S37 (≠ E39), D62 (= D57), L63 (≠ F58), N93 (= N84), A94 (= A85), S95 (= S86), T118 (≠ V106), L143 (≠ I133), K162 (= K152), P188 (= P177), G189 (≠ A178), V190 (≠ L179), S191 (≠ L180), L192 (= L181)
6gd0A Trypanosoma brucei ptr1 in complex with inhibitor 4g (f133) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:248/254 of 6gd0A
- active site: R13 (= R16), D147 (= D135), Y160 (= Y148), K164 (= K152)
- binding methyl 1-[4-[[(2-azanyl-1,3-benzothiazol-6-yl)carbonylamino]methyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S86), F96 (≠ W88), C154 (≠ S142), Y160 (= Y148), A198 (vs. gap), M199 (vs. gap), W207 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L145 (≠ I133), K164 (= K152), P190 (= P177), G191 (≠ A178), V192 (≠ L179), S193 (≠ L180), L194 (= L181)
6gcqA Trypanosoma brucei ptr1 in complex with inhibitor 2b (f192) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 6gcqA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 6-(trifluoromethylsulfanyl)-1,3-benzothiazol-2-amine: S94 (= S86), F96 (≠ W88), Y157 (= Y148), L192 (≠ F182), P193 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ Q15), R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), V189 (≠ L179), S190 (≠ L180), L191 (= L181)
6gcpA Trypanosoma brucei ptr1 in complex with inhibitor 2d (f186) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 6gcpA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 6-[(3,4-dichlorophenyl)methylsulfanyl]-1,3-benzothiazol-2-amine: S94 (= S86), F96 (≠ W88), C151 (≠ S142), F154 (≠ H145), Y157 (= Y148), P193 (vs. gap), M196 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180), L191 (= L181)
6gckA Trypanosoma brucei ptr1 in complex with inhibitor 1e (f206) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 6gckA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 4-[(2-azanyl-1,3-benzothiazol-6-yl)oxymethyl]benzenecarbonitrile: S94 (= S86), F96 (≠ W88), C151 (≠ S142), Y157 (= Y148), P193 (vs. gap), M196 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180), L191 (= L181)
4cm1A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cm1A
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 5-(p-tolyl)-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), D144 (= D135), Y157 (= Y148), L192 (≠ F182), P193 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), C143 (≠ S134), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180)
6rx6A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 4 (nmt- c0026) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6rx6A
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-(3-oxidanylpropyl)amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R16), S94 (= S86), F96 (≠ W88), Y154 (= Y148), P190 (vs. gap), M193 (vs. gap), W201 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180)
6rx0A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 3 (nmt- c0013) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6rx0A
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-ethyl-amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R16), S94 (= S86), F96 (≠ W88), P98 (vs. gap), F151 (≠ H145), Y154 (= Y148), P190 (vs. gap), M193 (vs. gap), W201 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), K158 (= K152), P184 (= P177), S187 (≠ L180)
6howA Trypanosoma brucei ptr1 in complex with the triazine inhibitor 2a (f219). (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6howA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding (2~{R})-1-(3,4-dichlorophenyl)-2-(4-nitrophenyl)-2~{H}-1,3,5-triazine-4,6-diamine: S94 (= S86), F96 (≠ W88), Y154 (= Y148), L189 (≠ F182), P190 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), D141 (= D135), K158 (= K152), G185 (≠ A178), V186 (≠ L179), S187 (≠ L180)
6gexA Trypanosoma brucei ptr1 in complex with inhibitor 2h (f246) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6gexA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding 4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]-~{N}-(phenylmethyl)benzamide: S94 (= S86), F96 (≠ W88), C148 (≠ S142), Y154 (= Y148), P190 (vs. gap), M193 (vs. gap), W201 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T115 (≠ V106), L139 (≠ I133), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180), L188 (= L181)
6gdoA Trypanosoma brucei ptr1 in complex with inhibitor 2g (f240) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 6gdoA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding methyl 1-[4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S86), F96 (≠ W88), C148 (≠ S142), Y154 (= Y148), M193 (vs. gap), W201 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), D141 (= D135), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180), L188 (= L181)
5k6aA Trypanosoma brucei pteridine reductase 1 (ptr1) in complex with compound 1 (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 5k6aA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding (2~{R})-2-(3-hydroxyphenyl)-6-oxidanyl-2,3-dihydrochromen-4-one: S94 (= S86), F96 (≠ W88), Y154 (= Y148), V186 (≠ L179), P190 (vs. gap), W201 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), D141 (= D135), K158 (= K152), G185 (≠ A178), S187 (≠ L180), L188 (= L181)
2x9nA High resolution structure of tbptr1 in complex with cyromazine (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:242/248 of 2x9nA
- active site: R13 (= R16), D141 (= D135), Y154 (= Y148), K158 (= K152)
- binding N~2~-cyclopropyl-1,3,5-triazine-2,4,6-triamine: R13 (= R16), S94 (= S86), F96 (≠ W88), Y154 (= Y148), L188 (= L181), P190 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T115 (≠ V106), L139 (≠ I133), C140 (≠ S134), K158 (= K152), P184 (= P177), G185 (≠ A178), S187 (≠ L180)
5jdcA Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 5jdcA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding (2S)-5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-2,3-dihydro-4H-1-benzopyran-4-one: F96 (≠ W88), D142 (= D135), M144 (≠ V137), C149 (≠ S142), L189 (= L181), L190 (≠ F182), P191 (vs. gap), W202 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T116 (≠ V106), L140 (≠ I133), K159 (= K152), G186 (≠ A178), S188 (≠ L180), L189 (= L181)
5jcxA Trypanosoma brucei ptr1 in complex with inhibitor np-29 (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:243/249 of 5jcxA
- active site: R13 (= R16), D142 (= D135), Y155 (= Y148), K159 (= K152)
- binding 3,5,7-trihydroxy-2-(2-hydroxyphenyl)-4H-1-benzopyran-4-one: F96 (≠ W88), Y155 (= Y148), P191 (vs. gap), M194 (vs. gap), W202 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H32 (≠ T35), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T116 (≠ V106), L140 (≠ I133), K159 (= K152), P185 (= P177), G186 (≠ A178), S188 (≠ L180), L189 (= L181)
Query Sequence
>AO356_16745 FitnessBrowser__pseudo5_N2C3_1:AO356_16745
MSSATAPILITGAAQRVGLHCARRLLEDGHPVIATYRTERPGVQTLRDLGAVVLFADFSS
ETGILAFIEQLKQHTDRLRAIVHNASAWLAEGPGSEAAAFNAMFGVHMLAPYLINLHCAE
LLLRSTPADIVHISDDVTRKGSARHIAYCATKAGLESLTLSFAAKFAPAIKVNGIAPALL
LFNPEDDAAYRAKALAKSALGIEPGSEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory