SitesBLAST
Comparing AO356_16830 FitnessBrowser__pseudo5_N2C3_1:AO356_16830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
53% identity, 98% coverage: 8:433/434 of query aligns to 14:428/430 of 5ti1H
- active site: D139 (= D134), H146 (= H141), E212 (= E206), E214 (= E208), D246 (= D240), R250 (= R244), Q253 (= Q247), K266 (= K260), T270 (= T264), E377 (= E381)
- binding magnesium ion: D139 (= D134), E212 (= E206), E214 (= E208), D246 (= D240)
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
50% identity, 96% coverage: 18:433/434 of query aligns to 10:415/419 of P16930
- N16 (= N24) to I: in TYRSN1; loss of activity; dbSNP:rs121965073
- A35 (= A42) to T: in TYRSN1; atypical mild phenotype
- F62 (≠ M70) to C: in TYRSN1; loss of activity
- A134 (= A142) to D: in TYRSN1; loss of activity; dbSNP:rs121965074
- C193 (= C200) to R: in TYRSN1; loss of activity
- D233 (= D240) to V: in TYRSN1; loss of activity; dbSNP:rs80338897
- W234 (= W241) to G: in TYRSN1; loss of activity; dbSNP:rs1555441595
- Q279 (≠ R286) to R: in TYRSN1; may affect splicing resulting in skipping of exon 8 alone or together with exon 9; lower activity as compared to wild type; dbSNP:rs121965078
- R341 (≠ Q358) to W: does not cause a clinically relevant phenotype; results in lower enzyme activity; dbSNP:rs11555096
- P342 (≠ A359) to L: in TYRSN1; loss of activity; dbSNP:rs779040832
- R381 (= R398) to G: in TYRSN1; loss of activity; dbSNP:rs121965077
- F405 (= F423) to H: in TYRSN1; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
48% identity, 96% coverage: 18:433/434 of query aligns to 12:417/419 of 1hyoB
- active site: D128 (= D134), H135 (= H141), E201 (= E206), E203 (= E208), D235 (= D240), R239 (= R244), Q242 (= Q247), K255 (= K260), T259 (= T264), E366 (= E381)
- binding acetate ion: Y130 (= Y136), V139 (= V145), R144 (= R150)
- binding calcium ion: D128 (= D134), E201 (= E206), E203 (= E208), D235 (= D240)
- binding 4-[hydroxy-[methyl-phosphinoyl]]-3-oxo-butanoic acid: D128 (= D134), F129 (= F135), Y130 (= Y136), H135 (= H141), Y161 (= Y166), K255 (= K260), G351 (= G366), T352 (= T367)
- binding magnesium ion: D235 (= D240), W236 (= W241), K255 (= K260), G258 (≠ L263), T259 (= T264)
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
48% identity, 96% coverage: 18:433/434 of query aligns to 10:415/419 of P35505
- D126 (= D134) binding
- E199 (= E206) binding
- E201 (= E208) binding ; mutation to G: Decrease in activity.
- D233 (= D240) binding ; binding
- K253 (= K260) binding
- T257 (= T264) binding
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
48% identity, 96% coverage: 18:433/434 of query aligns to 10:415/416 of 2hzyA
- active site: D126 (= D134), H133 (= H141), E199 (= E206), E201 (= E208), D233 (= D240), R237 (= R244), Q240 (= Q247), K253 (= K260), T257 (= T264), E364 (= E381)
- binding calcium ion: G122 (≠ N130), D123 (= D131)
- binding manganese (ii) ion: D126 (= D134), E199 (= E206), E201 (= E208), D233 (= D240)
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
48% identity, 96% coverage: 18:433/434 of query aligns to 10:415/416 of 1qcoA
- active site: K253 (= K260)
- binding acetoacetic acid: D126 (= D134), F127 (= F135), Y128 (= Y136), H133 (= H141), Y159 (= Y166), E199 (= E206), K253 (= K260), G349 (= G366), T350 (= T367)
- binding calcium ion: D126 (= D134), E199 (= E206), E201 (= E208), D233 (= D240)
- binding fumaric acid: Y128 (= Y136), V137 (= V145), R142 (= R150), Q240 (= Q247), Y244 (= Y251)
Query Sequence
>AO356_16830 FitnessBrowser__pseudo5_N2C3_1:AO356_16830
MTQSSPDRSWVASANGHADFPLQNLPLGVFSVDGGALRCGVAIGERIFDLQVALQAGLFD
GAAQQAVEAMAGGQLNGFFDLGRSARVALRERLLELLREDSPLRGKVEALEAKLLLLAAD
CQMHLPARINDYTDFYVGIEHAQNVGKLFRPDNPLLPNYKYVPIGYHGRASTIRPSGTDV
RRPRGQTLPAGQTEPTFGPCARLDYELELGIWIGKGNALGEPIPIGDAAEHIGGFCLLND
WSARDIQAWEYQPLGPFLSKSFLTSISPWVVTAEALEPFRRPQPARPEGDPQPLPYLLDT
RDQAGGAFDIELEVLLLTEAMVEQNLPAQRLTLSNTRYMYWTVAQMVAHHSVNGCQLQAG
DLFGSGTLSGPENHQFGSLLEITEGGKKPIELASGEVRRFLEDGDEIILRARCRREGFAS
IGFGECRGKILPAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory