Comparing AO356_17540 FitnessBrowser__pseudo5_N2C3_1:AO356_17540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 65% coverage: 277:818/837 of query aligns to 1:553/575 of P08839
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
37% identity, 65% coverage: 278:818/837 of query aligns to 1:552/572 of 2hwgA
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
36% identity, 61% coverage: 309:815/837 of query aligns to 37:551/570 of 2wqdA
Sites not aligning to the query:
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
36% identity, 60% coverage: 315:814/837 of query aligns to 43:550/573 of P23533
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
43% identity, 36% coverage: 524:828/837 of query aligns to 6:315/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
43% identity, 36% coverage: 526:828/837 of query aligns to 1:308/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
29% identity, 45% coverage: 416:795/837 of query aligns to 416:840/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
27% identity, 45% coverage: 416:795/837 of query aligns to 343:785/797 of 5jvjB
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
27% identity, 45% coverage: 416:795/837 of query aligns to 416:862/874 of 5jvlA
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
27% identity, 45% coverage: 416:795/837 of query aligns to 495:941/953 of Q39735
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 45% coverage: 416:795/837 of query aligns to 505:950/963 of O23404
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
27% identity, 44% coverage: 425:795/837 of query aligns to 96:508/520 of 5jvlB
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
26% identity, 44% coverage: 427:795/837 of query aligns to 425:859/874 of P22983
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
26% identity, 44% coverage: 427:795/837 of query aligns to 424:858/872 of 1kc7A
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
27% identity, 45% coverage: 416:795/837 of query aligns to 416:862/874 of 1vbgA
Sites not aligning to the query:
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
39% identity, 17% coverage: 1:143/837 of query aligns to 492:634/648 of P09323
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
27% identity, 45% coverage: 416:795/837 of query aligns to 489:935/947 of P11155
Sites not aligning to the query:
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
41% identity, 17% coverage: 12:153/837 of query aligns to 25:167/169 of P69783
Sites not aligning to the query:
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
41% identity, 17% coverage: 12:153/837 of query aligns to 17:159/161 of 1glcF
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
41% identity, 17% coverage: 12:153/837 of query aligns to 6:148/150 of 1o2fA
>AO356_17540 FitnessBrowser__pseudo5_N2C3_1:AO356_17540
MPNNNKELILSAPLSGPVLTLANVPDAVFASGAMGDGIAIDPLNDTLYAPCDAEVIHVAR
TGHAVTLRADNGAELLLHLGLDTVELQGEGFSMLVKEGARVSHGQPLLRYDVDKVALRCK
SLVSLLVITNGEHFQARPITLKGVKVGEPLLHILAKAVGQAEHHDQDSGIEVFGQVRIAH
RGGLHARPAALVRQTAQGFKSRSQLHFSGKSASCDSVMGMMGLAITEQAQVHVSCRGSDA
EAALQALLTTLSTALVEEAHASAPPPEPPRANAEEGVLHGVCAAPGLVTGPLVRLSGIQL
PEDIGGHAIEEQRQRLSDALAQVRGEIHLTLEHARARQHRDEEAIFSAHLALLEDPVLLD
AADLFIEQGSAAPHAWSRSIDTQCQVLQQLGSTLLAERANDLRDLRQRVLRVLLGEAWQF
DVAAGAIVAAQELTPSDLLQLSAQGVAGVCMVEGGATSHVAILARGKGLPCLVALGDELL
AQEQGQAVVLDADGGRLELTPTVERLAQVRQAQTRRTALRAQQQSLAHTPARTVDGVEVE
VAANVASSAEAGESLANGADGVGLLRTEFLFVDRHTAPDEEEQRQAYQAVLEAMGDKPVI
IRTIDVGGDKQLDYLPLPSEANPVLGLRGIRLAQVRPDLLDQQLRALLQTRPLDRCRILL
PMVTEVDELLHIRKRLDALGSELGLSERPQLGVMVEVPAAALLAEQLAEHADFLSIGTND
LSQYTLAMDRDHAGLAARVDALHPALLRLIAQTCAGAAKHGRWVGVCGALASDPLATPVL
IGLGVRELSVSPPQIGEIKDRVRHLDAAQCARLSNELLNLGSALAVRRACHRHWPLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory