Comparing AO356_17545 FitnessBrowser__pseudo5_N2C3_1:AO356_17545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8fdbA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
37% identity, 100% coverage: 1:335/336 of query aligns to 6:331/332 of 8fdbA
8fdbB Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
37% identity, 100% coverage: 1:335/336 of query aligns to 7:332/333 of 8fdbB
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
36% identity, 96% coverage: 1:324/336 of query aligns to 5:319/319 of 8eymA
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
32% identity, 72% coverage: 90:331/336 of query aligns to 104:361/366 of 1morA
Sites not aligning to the query:
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
32% identity, 72% coverage: 90:331/336 of query aligns to 104:361/366 of 1moqA
Sites not aligning to the query:
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
32% identity, 72% coverage: 90:331/336 of query aligns to 105:362/367 of 1mosA
Sites not aligning to the query:
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
33% identity, 72% coverage: 90:331/336 of query aligns to 346:603/608 of 4amvA
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
33% identity, 72% coverage: 90:331/336 of query aligns to 346:603/608 of 1jxaA
Sites not aligning to the query:
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
32% identity, 72% coverage: 90:331/336 of query aligns to 346:603/608 of 2j6hA
Sites not aligning to the query:
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
32% identity, 71% coverage: 90:327/336 of query aligns to 104:357/357 of 7dnrA
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
29% identity, 84% coverage: 42:324/336 of query aligns to 54:352/352 of 2pocB
Sites not aligning to the query:
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 87% coverage: 39:331/336 of query aligns to 401:712/717 of P14742
Sites not aligning to the query:
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
28% identity, 73% coverage: 86:331/336 of query aligns to 100:360/365 of 2zj4A
Sites not aligning to the query:
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
28% identity, 73% coverage: 86:331/336 of query aligns to 100:360/365 of 2zj3A
Sites not aligning to the query:
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
27% identity, 73% coverage: 86:331/336 of query aligns to 395:655/660 of 6svmA
Sites not aligning to the query:
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
27% identity, 73% coverage: 86:331/336 of query aligns to 398:658/663 of 6r4eA
Sites not aligning to the query:
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
27% identity, 73% coverage: 86:331/336 of query aligns to 434:694/699 of Q06210
Sites not aligning to the query:
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
27% identity, 73% coverage: 86:329/336 of query aligns to 394:652/652 of 6r4gA
Sites not aligning to the query:
2df8A Crystal structure of the ph0510 protein from pyrococcus horikoshii ot3 in complex with beta-d-fructopyranose-1-phosphate
27% identity, 89% coverage: 35:334/336 of query aligns to 31:324/325 of 2df8A
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
27% identity, 71% coverage: 86:324/336 of query aligns to 99:352/352 of 2v4mA
Sites not aligning to the query:
>AO356_17545 FitnessBrowser__pseudo5_N2C3_1:AO356_17545
MLEEALASHEAVERQLQRLDPALEEIAGRLRRQPPQVAMTVARGSSDHAASYFAYLTMQQ
LGIPVASLPMSVVTMQQAPLKVSGQVAFGFSQSGQSPDLVNSLRLLRKRGALSVALVNAT
DSPLEAACEFSVPLCADVESSVAATKSFIATLSASARLVAHWKADAELLEAGGALPEGLR
EAARQDWHSAVDALRDCQRLMVIGRGAGFAIAQEAALKFKETSAIQAEAFSSAEVRHGPM
ALIDHDYPLLVFAPRGAEQAGVLSLAADMRQRGARVLLAAPDDIVERDLTLSRAEHPALD
PILAIQSFYAMAASLAVARGLDPDQPRHLSKVTRTH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory