SitesBLAST
Comparing AO356_19665 FitnessBrowser__pseudo5_N2C3_1:AO356_19665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
26% identity, 78% coverage: 54:482/552 of query aligns to 26:462/502 of P07117
- R257 (= R286) mutation to C: Sodium-independent binding affinity for proline.
- C281 (≠ T314) mutation to S: Does not affect proline uptake activity. Confers resistance to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- C344 (≠ G376) mutation to S: Small decrease in proline uptake activity. Confers resistance to N-ethylmaleimide. Exhibits low Na(+)-dependent proline binding.
- C349 (≠ G381) mutation to S: Does not affect proline uptake activity. Sensitive to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- R376 (≠ K409) mutation R->E,Q: No change in activity.; mutation to K: Loss of activity.
B4EZY7 Sodium/sialic acid symporter SiaT; Na(+)-coupled sialic acid symporter; Sialic acid transporter from Proteus mirabilis (strain HI4320) (see paper)
22% identity, 52% coverage: 44:330/552 of query aligns to 17:304/496 of B4EZY7
- A56 (≠ G83) binding Na(+)
- T58 (≠ Y85) mutation to A: 2-fold increase in Neu5Ac transport.
- L59 (≠ M86) binding Na(+)
- S60 (= S87) mutation to A: Abolishes Neu5Ac transport.
- T63 (≠ S90) mutation to A: Abolishes Neu5Ac transport.
- Q82 (≠ S109) mutation to D: Abolishes Neu5Ac transport.
- R135 (≠ L164) mutation to E: Abolishes Neu5Ac transport.
- D182 (≠ Q210) binding Na(+); mutation to A: Abolishes Neu5Ac transport.
Sites not aligning to the query:
- 339 binding Na(+)
- 342 binding Na(+); binding Na(+); S→A: Abolishes Neu5Ac transport.
- 343 binding Na(+); S→A: Abolishes Neu5Ac transport.
- 345 binding Na(+); S→A: Reduces Neu5Ac transport.
- 346 binding Na(+); S→A: Slightly increases Neu5Ac transport.
5nv9A Substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site (see paper)
22% identity, 53% coverage: 44:334/552 of query aligns to 13:304/480 of 5nv9A
- binding sodium ion: A52 (≠ G83), T53 (≠ D84), L55 (≠ M86), S56 (= S87), V174 (≠ T206), D178 (≠ Q210)
- binding N-acetyl-beta-neuraminic acid: T54 (≠ Y85), S56 (= S87), I58 (≠ A89), T59 (≠ S90), G77 (≠ Y108), Q78 (≠ S109), R131 (≠ L164), F239 (vs. gap)
Sites not aligning to the query:
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
25% identity, 33% coverage: 39:220/552 of query aligns to 22:201/643 of Q92911
- A102 (≠ L120) natural variant: A -> P
Sites not aligning to the query:
- 226 mutation H->A,D,E,K: Significant loss of iodide transport activity but no effect on its localization to the cell membrane.
- 237 D→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization.
- 242 Required for homodimerization; Y→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471. Loss of iodide transport activity; when associated with F-535.
- 243 Required for homodimerization; T→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471.
- 471 Required for homodimerization; Q→A: No effect on localization to the cell membrane, iodide transport activity and homodimerization. Significant loss of homodimerization; when associated with A-242 or A243.
- 525 A→F: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Loss of iodide transport activity; when associated with A-242.
- 536 T → Q: requires 2 nucleotide substitutions
- 556 S → Q: requires 2 nucleotide substitutions
Query Sequence
>AO356_19665 FitnessBrowser__pseudo5_N2C3_1:AO356_19665
MIRRLLALLSIAAFAPGAWAADALTGAVQKQPLNVAAILMFVAFVGATLYITYWASKKNN
SAADYYAAGGKITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSIGFLVGWPIIL
FLIAERLRNLGKYTFADVASYRLGQTQIRTLSASGSLVVVAFYLIAQMVGAGKLIQLLFG
LDYHVAVILVGILMCLYVLFGGMLATTWVQIIKAVLLLSGASFMALMVMKHVNFDFNMLF
AEAVKVHPKGEAIMSPGGLVKDPISAFSLGLALMFGTAGLPHILMRFFTVSDAKEARKSV
LYATGFIGYFYILTFIIGFGAILLVSTNPAFKDAAGALLGGNNMAAVHLANAVGGSIFLG
FISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKANEKDEIRVSKITTIALAVLAI
GLGILFEKQNIAFMVGLAFSIAASCNFPVLLLSMYWKKLTTRGAMIGGWLGLVSAVGLMI
LGPTIWVQIMGHEKAIFPYEYPALFSMAIAFVGIWFFSITDKSAEGANERALFFPQFVRS
QTGLGASGAVNH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory