SitesBLAST
Comparing AO356_20105 FitnessBrowser__pseudo5_N2C3_1:AO356_20105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 92% coverage: 51:760/771 of query aligns to 9:719/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M80), G39 (= G81), Q40 (= Q82), H41 (≠ G83), V42 (= V84), A45 (≠ S87), G79 (≠ D121), G80 (= G122), S81 (= S123), S83 (= S125), V84 (≠ M126), G374 (= G416), F375 (= F417), L379 (≠ S421), L499 (≠ Y532), R500 (= R533), V624 (≠ I662), D625 (≠ N663), Q632 (= Q670), T687 (≠ L727), G688 (= G729), L689 (≠ V730), G690 (= G731), E691 (= E732)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
23% identity, 59% coverage: 206:659/771 of query aligns to 7:464/748 of 5y6qC
- active site: Q204 (= Q386), P239 (≠ S421), A310 (= A491), V316 (= V506), R344 (= R533)
- binding pterin cytosine dinucleotide: G233 (= G415), G234 (= G416), F235 (= F417), I461 (≠ V656), G462 (≠ D657), T463 (≠ C658), G464 (= G659)
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
24% identity, 48% coverage: 214:583/771 of query aligns to 552:923/1290 of 4uhxA
Sites not aligning to the query:
- active site: 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 237, 310, 311, 319, 320, 323, 324, 326, 329, 332, 333, 377, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
25% identity, 48% coverage: 214:583/771 of query aligns to 511:887/1254 of 8emtA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 215, 216, 217, 218, 219, 221, 222, 223, 296, 297, 306, 309, 310, 312, 319
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
25% identity, 48% coverage: 214:583/771 of query aligns to 495:854/1221 of 8emtB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 210, 211, 213, 214, 216, 217, 218, 291, 292, 300, 304, 305, 307, 314
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
3sr6C Crystal structure of reduced bovine xanthine oxidase in complex with arsenite (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/745 of 3sr6C
Sites not aligning to the query:
3b9jC Structure of xanthine oxidase with 2-hydroxy-6-methylpurine (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/758 of 3b9jC
Sites not aligning to the query:
3nvyC Crystal structure of bovine xanthine oxidase in complex with quercetin (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/756 of 3nvyC
- active site: Q197 (= Q386), E232 (≠ S421), R310 (≠ I502), H314 (≠ V506)
- binding 3,5,7,3',4'-pentahydroxyflavone: L78 (≠ P281), E232 (≠ S421), L303 (≠ V482), R310 (≠ I502)
Sites not aligning to the query:
- active site: 342, 690, 691
- binding 3,5,7,3',4'-pentahydroxyflavone: 344, 439, 440, 444, 509
3nvwC Crystal structure of bovine xanthine oxidase in complex with guanine (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/756 of 3nvwC
Sites not aligning to the query:
3eub4 Crystal structure of desulfo-xanthine oxidase with xanthine (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/756 of 3eub4
Sites not aligning to the query:
3nvzC Crystal structure of bovine xanthine oxidase in complex with indole-3- aldehyde (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3nvzC
Sites not aligning to the query:
3nvvC Crystal structure of bovine xanthine oxidase in complex with arsenite (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3nvvC
Sites not aligning to the query:
3ns1C Crystal structure of bovine xanthine oxidase in complex with 6- mercaptopurine (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3ns1C
Sites not aligning to the query:
3etrC Crystal structure of xanthine oxidase in complex with lumazine (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3etrC
Sites not aligning to the query:
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 486:794/1225 of 3ax7A
- active site: Q666 (= Q386), E701 (≠ S421), R779 (≠ I502), H783 (≠ V506)
- binding bicarbonate ion: R738 (≠ H452), H739 (= H453), I776 (= I486)
- binding calcium ion: A766 (≠ G476), S769 (≠ H479), R770 (= R480), S773 (≠ A483)
- binding fe2/s2 (inorganic) cluster: L643 (≠ M365)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: G695 (= G415), G696 (= G416), F697 (= F417), G698 (= G418)
Sites not aligning to the query:
- active site: 811, 1159, 1160
- binding bicarbonate ion: 808, 809, 814, 817
- binding calcium ion: 806, 807
- binding flavin-adenine dinucleotide: 45, 197, 198, 199, 200, 201, 202, 203, 204, 205, 278, 279, 283, 287, 288, 291, 292, 294, 295, 300, 301, 345
- binding fe2/s2 (inorganic) cluster: 41, 42, 43, 45, 47, 48, 50, 70, 72, 112, 113, 115, 147, 149
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 111, 149, 810, 811, 937, 938, 939, 977, 978, 979, 981, 1093, 1160
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 549:857/1286 of 3unaA
Sites not aligning to the query:
- active site: 874, 1222, 1223
- binding calcium ion: 869, 870
- binding carbonate ion: 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 430, 431, 471, 478
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 549:857/1286 of 3bdjA
Sites not aligning to the query:
- active site: 874, 1222, 1223
- binding Oxypurinol: 876, 971, 972, 1040, 1041, 1223
- binding calcium ion: 869, 870
- binding carbonate ion: 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
- binding Oxo(sulfanyl)molybdenum(IV) ION: 872, 873, 874, 1223
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 553:861/1298 of 1v97A
- active site: Q733 (= Q386), E768 (≠ S421), R846 (≠ I502), H850 (≠ V506)
- binding calcium ion: A833 (≠ G476), S836 (≠ H479), R837 (= R480), S840 (≠ A483)
- binding fe2/s2 (inorganic) cluster: L710 (≠ M365)
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: E768 (≠ S421), L839 (≠ V482), R846 (≠ I502)
Sites not aligning to the query:
- active site: 878, 1226, 1227
- binding calcium ion: 873, 874
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: 880, 975, 980, 1042, 1044, 1045, 1227
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 551:859/1291 of 3amzA
Sites not aligning to the query:
- active site: 876, 1224, 1225
- binding bicarbonate ion: 873, 874, 878, 879, 882
- binding calcium ion: 871, 872
- binding flavin-adenine dinucleotide: 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1,4-dihydronicotinamide adenine dinucleotide: 328, 329, 330, 365, 366, 402, 403, 430, 432, 433, 473, 480, 1189
- binding uric acid: 878, 973, 974, 1043, 1225
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
23% identity, 39% coverage: 221:517/771 of query aligns to 554:862/1290 of 1n5xA
Sites not aligning to the query:
- active site: 879, 1227, 1228
- binding flavin-adenine dinucleotide: 43, 44, 229, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: 881, 976, 977, 978, 981
Query Sequence
>AO356_20105 FitnessBrowser__pseudo5_N2C3_1:AO356_20105
MSRLPDDFMLSNLSRRGFLKGASATGVLVLAATWGLPDAFAEEKKFGAEGMPHGAVDDPK
VYVSIASDGSVTVICNRSEMGQGVRTSLSMVVADELDADWALVKVKQAPADEARFGNQDT
DGSRSMRHWYEPMRRCGAAARTMLELAAAAQWKVPVGECHAQLHKVLHQPSGRELGYGEL
AAAASALAVPARDSLRLKQPSEFRYIGKEASRAIDGADIVNGRAVFGADVHFDGMLYAVI
ARPPVYGGKVKSVDSSAALKVPGVVKVVQIEGRPLPSEFQPLGGVAVVAKNTWAAIKGRE
ALKIQWDDGPNAGYDSIAYRKELEAAALKPGKVVRSSGDLDDALAKADSTLEASYYLPHL
SQSPMEPMVAVARFKDGQCEAWAPSQAPQVTRERVAERLGIPFEKVTVNITLLGGGFGRK
SKPDFVVEAAVLAKEFPGQAVRVQWTREDDIHHSYFHTVSAEYLKAGLNQDGMPSGWLHR
TVAPSITALFAPGMTHEAPFEIGMGVTNMAYAIPNLRLENPEAVAHARVGWYRSVSNIPH
GFAIQSFIDELAHKAGQDPLKYQVKLLGPDRKIDPRTLSEEWNYGESPERYPIDTARIRT
VLETAAKAAGWGRELPKGRGLGLAVHYSFVTYVAAVLEVEVKDDGTVIVHKADIAVDCGP
QINPERIRSQFEGACVMGLGNAMVGEISFKDGKVQQDNFHMYEVARMSLAPKEVAVHLVT
PPGEVPLGGVGEPGVPPIAPALCNAIFAATGQRIRNLPVRYQLQGWQQAKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory