Comparing AO356_20245 FitnessBrowser__pseudo5_N2C3_1:AO356_20245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
61% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
61% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
61% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abeA
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
45% identity, 90% coverage: 32:332/334 of query aligns to 1:301/301 of 4kzkA
>AO356_20245 FitnessBrowser__pseudo5_N2C3_1:AO356_20245
MNHRRGIRSLCRAALAVTAVSLSSSLLAADPVKIGFLVKQAEEPWFQTEWAFAEKASKDK
GFELIKIAVPDGEKTLSAIDSLAANGAKGFVICPPDVSLGPAIMAKAKLNDLKVIAVDDR
FVDANGKFMEDVPYLGMAAFEVGQKQGAAMAAEAKKRNWEWKDTYAVINTFNELDTGKKR
TDGSVDALKKAGMPADHILYSALKTLDVPGSMDSTNSALVKLPSAAKNLIIGGMNDNTVL
GGVRATEAAGFKAANVIGIGINGTDAIGELKKPDSGFFGSMLPSPHIEGYKTAEMMYEWI
TTGKEPPKYTAMDEVTLITRENFKQELEKIGLWN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory