Comparing AO356_20285 AO356_20285 2-dehydro-3-deoxy-6-phosphogalactonate aldolase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
46% identity, 94% coverage: 11:203/206 of query aligns to 9:201/205 of Q6BF16
2v82A Kdpgal complexed to kdpgal (see paper)
46% identity, 94% coverage: 11:203/206 of query aligns to 8:200/205 of 2v82A
Sites not aligning to the query:
1wa3D Mechanism of the class i kdpg aldolase (see paper)
35% identity, 96% coverage: 2:199/206 of query aligns to 2:196/203 of 1wa3D
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
35% identity, 73% coverage: 19:168/206 of query aligns to 27:175/216 of 1mxsA
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
35% identity, 73% coverage: 19:168/206 of query aligns to 37:185/226 of P00885
Sites not aligning to the query:
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
36% identity, 72% coverage: 21:168/206 of query aligns to 24:170/210 of 6oviA
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
35% identity, 72% coverage: 21:168/206 of query aligns to 27:173/213 of 1euaA
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 72% coverage: 21:168/206 of query aligns to 27:173/213 of P0A955
Sites not aligning to the query:
2c0aB Mechanism of the class i kdpg aldolase (see paper)
34% identity, 72% coverage: 21:168/206 of query aligns to 28:174/214 of 2c0aB
Sites not aligning to the query:
1wauA Structure of kdpg aldolase e45n mutant (see paper)
34% identity, 72% coverage: 21:168/206 of query aligns to 27:173/213 of 1wauA
Sites not aligning to the query:
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
32% identity, 69% coverage: 26:168/206 of query aligns to 29:176/216 of 3vcrA
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
32% identity, 72% coverage: 22:169/206 of query aligns to 25:170/209 of 5xsfA
Sites not aligning to the query:
>AO356_20285 AO356_20285 2-dehydro-3-deoxy-6-phosphogalactonate aldolase
MLTQALAHNGLIAILRGLRPEEAAAIGEVLYSAGFRVIEVPLNSPEPYESIRILRSTLPA
DCLIGAGTVLTPEQVEQVKAAGGQVIVMPHSDPKVLRAAKAAGLYLSPGVATPTEAFAAL
AEGAHVLKMFPAEQMGPAVVKAWLAVLPAGTVLVPVGGITPDNMAVFVEAGVKGFGLGSG
LFKPGLTADEVAVRAKAYVAAWNALN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory