SitesBLAST
Comparing AO356_20805 FitnessBrowser__pseudo5_N2C3_1:AO356_20805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of P71447
- D8 (= D17) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (= D19) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (= T25) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (≠ Y29) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (≠ I53) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (= G54) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (≠ A57) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (≠ L60) mutation to A: Wild-type activity.
- K76 (≠ R88) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D177) mutation to A: Impaired, but active with an increase in the affinity for G1P.
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of 2wf9A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding beryllium trifluoride ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of 1o03A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D17), L9 (≠ M18), D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S114 (≠ T116), A115 (≠ S117), S116 (= S118), K117 (≠ S119), K145 (= K152)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of 1lvhA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/224 of 5olwA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding calcium ion: D8 (= D17), D10 (= D19), P89 (vs. gap), V92 (vs. gap), E124 (≠ K126), N127 (≠ D132), E169 (= E176), D170 (= D177), S171 (= S178)
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D17), L9 (≠ M18), D10 (= D19), H20 (≠ Y29), G46 (= G54), S114 (≠ T116), A115 (≠ S117), S116 (= S118), K117 (≠ S119), K145 (= K152)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/219 of 1z4nA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (≠ Y29), W24 (≠ T33), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding magnesium ion: D8 (= D17), D10 (= D19), E169 (= E176), D170 (= D177)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 4c4rA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S52 (≠ L60), S116 (= S118), K117 (≠ S119)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 3zi4A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding Scandium Tetrafluoride: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf8A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding beryllium trifluoride ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118), K117 (≠ S119)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S52 (≠ L60), A115 (≠ S117), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf7A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding tetrafluoroaluminate ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), K145 (= K152)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D19), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf6A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding tetrafluoroaluminate ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf5A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and trifluoromagnesate (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf5A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
4c4sA Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
30% identity, 80% coverage: 12:195/231 of query aligns to 3:185/215 of 4c4sA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S111 (≠ T116), A112 (≠ S117), K142 (= K152), E166 (= E176), D167 (= D177)
- binding (1R)-1,5-anhydro-1-[(S)-fluoro(phosphono)methyl]-D-glucitol: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S113 (= S118)
- binding magnesium ion: D8 (= D17), D10 (= D19), D167 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S111 (≠ T116), A112 (≠ S117), K142 (= K152)
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 10:229/231 of query aligns to 8:234/690 of 7ocnA
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 82% coverage: 7:195/231 of query aligns to 70:260/1055 of Q8VZ10
- D80 (= D17) mutation to N: Complete rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
Sites not aligning to the query:
- 431:434 CINC→SINS: No rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
- 859 E→K: In soq1-2; high light intensity-dependent and irreversible nonphotochemical quenching (NPQ) due to a decrease in chlorophyll excited-state lifetime.
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 10:229/231 of query aligns to 8:234/686 of 7ocqA
Sites not aligning to the query:
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-4~{H}-pyridin-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-3,4,5-tris(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: 252, 253, 254, 279, 280, 335, 369, 370
7ocpA NADPH bound to the dehydrogenase domain of the bifunctional mannitol- 1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 10:229/231 of query aligns to 8:234/688 of 7ocpA
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 250, 251, 253, 254, 279, 280, 334, 335, 336, 339, 369, 370
5o6pA Structure of beta-phosphoglucomutase d10n mutant in complex with glucose-1,6-bisphosphate
29% identity, 80% coverage: 12:195/231 of query aligns to 2:187/209 of 5o6pA
- active site: D7 (= D17), L8 (≠ M18), N9 (≠ D19), T15 (= T25), K44 (≠ I53), S113 (≠ T116), A114 (≠ S117), K144 (= K152), E168 (= E176), D169 (= D177)
- binding 1,6-di-O-phosphono-beta-D-glucopyranose: D7 (= D17), L8 (≠ M18), N9 (≠ D19), H19 (≠ Y29), L43 (≠ I52), K44 (≠ I53), G45 (= G54), V46 (≠ R55), R48 (≠ A57), S113 (≠ T116), A114 (≠ S117), S115 (= S118), K116 (≠ S119), K144 (= K152)
- binding magnesium ion: D7 (= D17), N9 (≠ D19), D169 (= D177)
Query Sequence
>AO356_20805 FitnessBrowser__pseudo5_N2C3_1:AO356_20805
MNAPLKEFGPIKAVIFDMDGLLLDTEGIYTEVTSIIAERYGRTFDWSVKQNIIGRGATDL
ANYVVQALELPITPQEFLVIREPLMRERFPHALGMPGAEELVRHLKAHNIPIAVGTSSSS
PTFALKTTLHRDWFALFDCIVTADDPEVGAAKPAPDIFLTAARRLGVEPRDCLVFEDSPF
GVTAAKAAGMTAIAIPDSAMADEKYAHADGIIRSLKMFQPSLCGLPELEWA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory