Comparing AO356_21620 FitnessBrowser__pseudo5_N2C3_1:AO356_21620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
28% identity, 82% coverage: 27:261/288 of query aligns to 50:286/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
26% identity, 96% coverage: 2:277/288 of query aligns to 3:275/285 of 7cagA
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
23% identity, 79% coverage: 43:270/288 of query aligns to 252:498/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
23% identity, 79% coverage: 43:270/288 of query aligns to 237:483/490 of 4ki0F
>AO356_21620 FitnessBrowser__pseudo5_N2C3_1:AO356_21620
MNKVQNNKAWWLVLPVFLLVAFSAVIPMMTVVNYSVQDIFDQSSRYFVGADWYKQVLLDP
RLHDSLLRQFIYSACVLLIEIPLGIAIALTMPTKGKWSSLVLIILAIPLLIPWNVVGTIW
QIFGRADIGLLGSTLNGLGINYNYAANTMDAWVTVLVMDVWHWTSLVALLCYSGLRAIPD
VYYQAARIDRASNWAVFRHIQLPKMKSVLLIAVMLRFMDSFMIYTEPFVLTGGGPGNATT
FLSQTLTQMAIGQFDLGPAAAFSLVYFLIILLVSWLFYTAMTHSDANR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory