SitesBLAST
Comparing AO356_21690 FitnessBrowser__pseudo5_N2C3_1:AO356_21690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77454 Glutaminase 1; EC 3.5.1.2 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 94% coverage: 19:302/302 of query aligns to 24:308/310 of P77454
- K69 (= K64) mutation to A: Loss of activity.
- N117 (= N111) mutation to A: Loss of activity.
- S160 (= S154) mutation to A: Loss of activity.
- E161 (= E155) mutation to A: Strongly reduced activity.
- Q162 (≠ Y156) mutation to A: No effect.
- N168 (= N162) mutation to A: Loss of activity.
- Y192 (= Y186) mutation to A: Loss of activity.
- Y244 (= Y238) mutation to A: Loss of activity.
- S260 (= S254) mutation to A: Reduced activity.
- K294 (≠ A288) modified: N6-acetyllysine
3ihbA Crystal structure analysis of mglu in its tris and glutamate form (see paper)
36% identity, 98% coverage: 1:295/302 of query aligns to 9:300/450 of 3ihbA
- active site: S64 (= S61), K67 (= K64), Y191 (= Y186), Y243 (= Y238), V261 (= V256)
- binding glutamic acid: Q63 (= Q60), S64 (= S61), N114 (= N111), E160 (= E155), N167 (= N162), G260 (= G255), V261 (= V256)
6umcB Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 6umcB
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[(3R)-3-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), E189 (= E101), Y258 (≠ L168)
6ujgA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 6ujgA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-{5-[(3S)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), Y258 (≠ L168)
5wj6A Crystal structure of glutaminasE C in complex with inhibitor 2-phenyl- n-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino) piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide (upgl-00004) (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5wj6A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), E189 (= E101), Y258 (≠ L168)
5i94A Crystal structure of human glutaminasE C in complex with the inhibitor upgl-00019 (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5i94A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), Y258 (≠ L168)
6umfA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6umfA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-(5-{[1-(5-amino-1,3,4-thiadiazol-2-yl)piperidin-4-yl]oxy}-1,3,4-thiadiazol-2-yl)-2-phenylacetamide: L185 (= L95), L187 (≠ E99), Y258 (≠ L168)
6uljA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6uljA
6ulaA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ulaA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-cyclopropyl-N-{5-[4-({5-[(cyclopropylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), Y258 (≠ L168)
6ukbA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ukbA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-[5-(4-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]oxy}piperidin-1-yl)-1,3,4-thiadiazol-2-yl]acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), Y258 (≠ L168)
6ujmA Crystal structure of human gac in complex with inhibitor upgl00013
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ujmA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-{5-[(3R)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), Y258 (≠ L168)
6loxA Crystal structure of human glutaminase with macrocyclic inhibitor (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 93:377/407 of 6loxA
- active site: S148 (= S61), K151 (= K64), Y276 (= Y186), Y328 (= Y238), V346 (= V256)
- binding (E)-15,22-Dioxa-4,11-diaza-5(2,5)-thiadiazola-10(3,6)-pyridazina-1,14(1,3)-dibenzenacyclodocosaphan-18-ene-3,12-dione: K182 (≠ S94), L183 (= L95), F184 (≠ L98), L185 (≠ E99), N186 (≠ F100), Y256 (≠ L168)
6umdB Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6umdB
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-(pyridin-3-yl)-N-(5-{4-[(5-{[(pyridin-3-yl)acetyl]amino}-1,3,4-thiadiazol-2-yl)amino]piperidin-1-yl}-1,3,4-thiadiazol-2-yl)acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), E189 (= E101), Y258 (≠ L168)
6ul9B Crystal structure of human gac in complex with inhibitor upgl00023
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ul9B
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[(1-{5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}azetidin-3-yl)oxy]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), E189 (= E101), Y258 (≠ L168)
5fi7A Crystal structure of human gac in complex with inhibitor upgl_00015: 2-phenyl-~{n}-[5-[(3~{s})-3-[[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5fi7A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-~{N}-[5-[(3~{S})-3-[[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), E189 (= E101), Y258 (≠ L168)
5fi6A Crystal structure of human gac in complex with inhibitor upgl_00011: 2-phenyl-~{n}-[5-[[(3~{s})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5fi6A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-~{N}-[5-[[(3~{S})-1-[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2-yl]ethanamide: R181 (≠ P91), F182 (= F92), K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), E189 (= E101), Y258 (≠ L168)
5fi2A Crystal structure of human gac in complex with inhibitor upgl_00009: 2-phenyl-~{n}-[5-[[(3~{r})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol- 2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5fi2A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-~{N}-[5-[[(3~{R})-1-[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2-yl]ethanamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), Y258 (≠ L168)
8gwrB Near full length kidney type glutaminase in complex with 2,2-dimethyl- 2,3-dihydrobenzo[a] phenanthridin-4(1h)-one (ddp) (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 88:372/501 of 8gwrB
Sites not aligning to the query:
5w2jB Crystal structure of dimeric form of mouse glutaminasE C (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 96:380/411 of 5w2jB
Sites not aligning to the query:
8jueA Crystal structure of glutaminasE C in complex with compound 11 (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 88:372/401 of 8jueA
Query Sequence
>AO356_21690 FitnessBrowser__pseudo5_N2C3_1:AO356_21690
MQALLNEILDAVRPLIGQGKVADYIPALGTVVPNQLGIAVYGNDGELYCAGDAETAFSVQ
SISKVFSLVQAIGHSGEAIWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPALSMRDFVRRLSGNPQVMVDGKVAESEYQHRARNAAMAYLMQSFGNFHNDVE
AVLRSYFSHCALRMSCIDLARAFCFLANDGFCKHSGEQILSARQTQQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNAAGNSLAGMAALELMSQRIGWS
VF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory