SitesBLAST
Comparing AO356_21850 FitnessBrowser__pseudo5_N2C3_1:AO356_21850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
51% identity, 99% coverage: 3:311/311 of query aligns to 4:312/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G203), R205 (= R204), S230 (= S229), R231 (= R230), A232 (= A231), Q244 (= Q243), V245 (= V244), G246 (= G245), T248 (= T247), G261 (= G260), I262 (= I261), S263 (= S262), A265 (= A264), Q267 (= Q266), H268 (= H267), N282 (= N281), K283 (≠ Q282), D300 (= D299), L301 (= L300)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
51% identity, 99% coverage: 3:311/311 of query aligns to 22:330/333 of P13804
- G116 (= G97) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (≠ S152) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R204) binding
- S248 (= S229) binding
- R249 (= R230) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 244:247) binding
- T266 (= T247) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 262:267) binding
- N300 (= N281) binding
- DL 318:319 (= DL 299:300) binding
Sites not aligning to the query:
- 20:204 Domain I
- 205:333 Domain II
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
55% identity, 83% coverage: 55:311/311 of query aligns to 53:307/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G203), R200 (= R204), G201 (= G205), S225 (= S229), R226 (= R230), A227 (= A231), Q239 (= Q243), V240 (= V244), G241 (= G245), T243 (= T247), G256 (= G260), I257 (= I261), S258 (= S262), A260 (= A264), Q262 (= Q266), H263 (= H267), N277 (= N281), K278 (≠ Q282), D295 (= D299), L296 (= L300)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
34% identity, 92% coverage: 25:311/311 of query aligns to 94:388/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (≠ M112), R200 (= R127), M281 (≠ R204), G282 (= G205), R307 (= R230), A308 (= A231), Q320 (= Q243), V321 (= V244), G322 (= G245), Q323 (= Q246), T324 (= T247), G337 (= G260), I338 (= I261), S339 (= S262), Q343 (= Q266), H344 (= H267), N358 (= N281), K359 (≠ Q282), L377 (= L300)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
40% identity, 69% coverage: 93:307/311 of query aligns to 97:320/331 of 5ol2A
- binding calcium ion: D188 (≠ A175)
- binding flavin-adenine dinucleotide: T117 (≠ L113), R136 (= R127), I147 (≠ V138), G216 (= G203), R217 (= R204), G218 (= G205), S242 (= S229), R243 (= R230), A244 (= A231), Q256 (= Q243), V257 (= V244), G258 (= G245), T260 (= T247), G273 (= G260), I274 (= I261), S275 (= S262), A277 (= A264), Q279 (= Q266), H280 (= H267), N294 (= N281), K295 (≠ Q282), D312 (= D299), V313 (≠ L300)
Sites not aligning to the query:
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
37% identity, 78% coverage: 66:307/311 of query aligns to 86:328/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (≠ M112), R144 (= R127), I155 (≠ V138), G224 (= G203), R225 (= R204), G226 (= G205), S250 (= S229), R251 (= R230), A252 (= A231), Q264 (= Q243), V265 (= V244), G266 (= G245), Q267 (= Q246), S268 (≠ T247), G281 (= G260), I282 (= I261), S283 (= S262), S285 (≠ A264), Q287 (= Q266), H288 (= H267), N302 (= N281), K303 (≠ Q282), D320 (= D299), A321 (≠ L300)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
33% identity, 100% coverage: 1:311/311 of query aligns to 1:291/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G203), R184 (= R204), G185 (= G205), S209 (= S229), R210 (= R230), Q223 (= Q243), I224 (≠ V244), G225 (= G245), T227 (= T247), G240 (= G260), V241 (≠ I261), S242 (= S262), A244 (= A264), Q246 (= Q266), H247 (= H267), N261 (= N281), K262 (≠ Q282), D279 (= D299), Y280 (≠ L300)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 97% coverage: 5:307/311 of query aligns to 15:327/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (≠ M112), T126 (≠ L113), R144 (= R127), I155 (≠ V138), R224 (= R204), G225 (= G205), T249 (≠ S229), R250 (= R230), Q263 (= Q243), I264 (≠ V244), G265 (= G245), L266 (≠ Q246), S267 (≠ T247), G280 (= G260), I281 (= I261), S282 (= S262), Q286 (= Q266), N301 (= N281), S302 (≠ Q282), D303 (= D283), D319 (= D299), L320 (= L300)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
32% identity, 98% coverage: 4:307/311 of query aligns to 8:323/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (≠ L113), R140 (= R127), T142 (≠ I129), G219 (= G203), K220 (≠ R204), G221 (= G205), S245 (= S229), R246 (= R230), A247 (= A231), Q259 (= Q243), V260 (= V244), G261 (= G245), Q262 (= Q246), T263 (= T247), G276 (= G260), S278 (= S262), Q282 (= Q266), H283 (= H267), N297 (= N281), I298 (≠ Q282), L316 (= L300)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
40% identity, 36% coverage: 192:302/311 of query aligns to 199:310/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
39% identity, 36% coverage: 192:302/311 of query aligns to 198:309/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G203), R210 (= R204), G211 (= G205), S235 (= S229), A236 (≠ R230), P237 (≠ A231), Q249 (= Q243), V250 (= V244), G251 (= G245), Q252 (= Q246), S253 (≠ T247), G267 (= G260), I268 (= I261), S269 (= S262), S271 (≠ A264), Q273 (= Q266), H274 (= H267), N288 (= N281), T289 (≠ Q282), D306 (= D299), I307 (≠ L300)
Query Sequence
>AO356_21850 FitnessBrowser__pseudo5_N2C3_1:AO356_21850
MRTLVIAEHSAGQLTAGTWSAVTAAMALGTETDLLVMGGTAASAVAQQAALTQGLARVLL
AQGAMFENALAENVQPLVTSLVAEGYTHVVADASSMGRNVLPRIAASLDVGMLSDVTQIV
STDTFQRPIYAGNAIATVQSLDPIKLLTVRASAFAQALSHEHRCEVVVVEGGQSASNVRF
VSEQLTASERPDLSSARVVVSGGRGMQGKEHFALIERVADKLGGAVGASRAAVDSGFAPN
DLQVGQTGKIVAPELYIAAGISGAIQHLAGMSGSKVIVAINQDAEAPIAQVADYMWVADL
FEALPALEKAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory