Comparing AO356_22845 FitnessBrowser__pseudo5_N2C3_1:AO356_22845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
93% identity, 98% coverage: 5:356/358 of query aligns to 1:352/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
91% identity, 97% coverage: 2:349/358 of query aligns to 1:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
90% identity, 98% coverage: 3:353/358 of query aligns to 1:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
87% identity, 96% coverage: 3:344/358 of query aligns to 1:320/320 of 7xntC
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
33% identity, 94% coverage: 13:347/358 of query aligns to 295:624/635 of Q88JU3
Sites not aligning to the query:
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
34% identity, 94% coverage: 13:347/358 of query aligns to 297:621/624 of 5hmqD
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
36% identity, 78% coverage: 72:349/358 of query aligns to 79:360/362 of 1t47A
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 91% coverage: 31:356/358 of query aligns to 42:382/393 of P32755
Sites not aligning to the query:
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
30% identity, 80% coverage: 72:356/358 of query aligns to 87:382/393 of Q02110
Sites not aligning to the query:
7yvvA Acmp1, r-4-hydroxymandelate synthase
29% identity, 79% coverage: 68:349/358 of query aligns to 64:334/335 of 7yvvA
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
28% identity, 91% coverage: 31:357/358 of query aligns to 34:375/376 of 5ec3A
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
28% identity, 88% coverage: 31:346/358 of query aligns to 29:343/357 of O52791
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
28% identity, 90% coverage: 31:353/358 of query aligns to 36:373/374 of 8im2A
2r5vA Hydroxymandelate synthase crystal structure (see paper)
29% identity, 88% coverage: 31:346/358 of query aligns to 28:341/346 of 2r5vA
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
27% identity, 89% coverage: 31:349/358 of query aligns to 36:369/371 of 8im3A
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
27% identity, 89% coverage: 30:349/358 of query aligns to 23:342/343 of 3zgjB
6isdA Crystal structure of arabidopsis thaliana hppd complexed with sulcotrione (see paper)
30% identity, 79% coverage: 64:346/358 of query aligns to 89:367/369 of 6isdA
7ezqA Complex structure of athppd with inhibitor y15832
30% identity, 79% coverage: 64:346/358 of query aligns to 91:376/382 of 7ezqA
7x8iA Crystal structure of athppd-shikonin complex (see paper)
30% identity, 79% coverage: 64:346/358 of query aligns to 91:376/380 of 7x8iA
7x64A Crystal structure of athppd-y18027 complex (see paper)
30% identity, 79% coverage: 64:346/358 of query aligns to 91:376/380 of 7x64A
>AO356_22845 FitnessBrowser__pseudo5_N2C3_1:AO356_22845
MADLYENPMGLMGFEFIEFASPTPNTLEPIFEIMGFTKVATHRSKDVHLYRQGAINLILN
NEPHSVASYFAAEHGPSVCGMAFRVKDSQLAYKRALELGAQPIHIETGPMELNLPAIKGI
GGAPLYLIDRFGEGSSIYDIDFVFLEGVDRNPVGAGLKIIDHLTHNVYRGRMAYWAGFYE
KLFNFREIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEGIQ
HVAFLTDDLIKTWDHLKSIGMRFMTAPPDTYYEMLEGRLPNHGEPVNELQSRGILLDGAS
EQGDKRLLLQIFSETLMGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGVLATE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory