Comparing AO356_23520 FitnessBrowser__pseudo5_N2C3_1:AO356_23520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 82% coverage: 1:233/284 of query aligns to 4:260/319 of Q8ZKR2
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
30% identity, 82% coverage: 1:232/284 of query aligns to 1:256/306 of 5eynA
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
26% identity, 80% coverage: 7:234/284 of query aligns to 6:250/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
26% identity, 80% coverage: 7:234/284 of query aligns to 6:250/297 of 1tz6A
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 82% coverage: 1:232/284 of query aligns to 5:260/310 of 5yggA
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
28% identity, 84% coverage: 7:244/284 of query aligns to 19:277/312 of 3in1A
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
27% identity, 82% coverage: 1:232/284 of query aligns to 1:237/282 of 7fcaD
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
26% identity, 82% coverage: 1:233/284 of query aligns to 9:253/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
26% identity, 82% coverage: 1:233/284 of query aligns to 10:254/304 of 3ih0A
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
29% identity, 75% coverage: 22:233/284 of query aligns to 34:256/300 of 8cqxA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 79% coverage: 8:232/284 of query aligns to 24:258/309 of Q53W83
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 79% coverage: 8:232/284 of query aligns to 24:258/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 79% coverage: 8:232/284 of query aligns to 24:258/300 of 1v1bA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
31% identity, 81% coverage: 4:233/284 of query aligns to 2:221/265 of 6znxC
Sites not aligning to the query:
8omdA Crystal structure of mkhk in complex with compound-4 (see paper)
27% identity, 83% coverage: 24:260/284 of query aligns to 38:291/296 of 8omdA
Sites not aligning to the query:
6p2dA Structure of mouse ketohexokinasE-C in complex with fructose and adp
27% identity, 83% coverage: 24:260/284 of query aligns to 38:291/296 of 6p2dA
Sites not aligning to the query:
2xtbA Crystal structure of trypanosoma brucei rhodesiense adenosine kinase complexed with activator (see paper)
24% identity, 85% coverage: 23:262/284 of query aligns to 62:337/337 of 2xtbA
Sites not aligning to the query:
3otxA Crystal structure of trypanosoma brucei rhodesiense adenosine kinase complexed with inhibitor ap5a (see paper)
24% identity, 80% coverage: 23:248/284 of query aligns to 58:319/338 of 3otxA
Sites not aligning to the query:
4n09A Structure of trypanosoma brucei brucei adenosine kinase in complex with adenosine and amppnp (see paper)
24% identity, 80% coverage: 23:248/284 of query aligns to 61:322/345 of 4n09A
Sites not aligning to the query:
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
26% identity, 85% coverage: 20:260/284 of query aligns to 53:312/338 of 3uboA
Sites not aligning to the query:
>AO356_23520 FitnessBrowser__pseudo5_N2C3_1:AO356_23520
MASLIAVGDNTLDVYLDQTIEYPGGNALNVAVFAARLGARSAYLGCVGDDRHGQYLLDCL
QQEAVDASRCRTLSGANGWACVDNVEGERVFLGSDPGVCRQLRLDADDLAYIGTFPLAHS
SLYSGLEDQLAQVRQASGCLSFDFSDNWVEFDWQALIQHVDVAFFSAADLSTAQAIELAN
AMRAKGPAVVVITRGAQGALAVDSQGVHERAARPCAFVDSMGAGDGFIAAFLLAWQARHP
LAECLARGVDHAGQVCGWAGGFGHGRTVDSQRVQQLKHALNIQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory