SitesBLAST
Comparing AO356_23545 FitnessBrowser__pseudo5_N2C3_1:AO356_23545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 69% coverage: 26:217/279 of query aligns to 28:221/378 of P69874
- F45 (= F43) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C52) mutation to T: Loss of ATPase activity and transport.
- L60 (= L58) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I74) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V131) mutation to M: Loss of ATPase activity and transport.
- D172 (= D168) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 77% coverage: 15:228/279 of query aligns to 4:216/393 of P9WQI3
- H193 (= H202) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 68% coverage: 30:218/279 of query aligns to 18:208/369 of P19566
- L86 (= L95) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P170) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D175) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
41% identity, 68% coverage: 30:218/279 of query aligns to 18:208/371 of P68187
- A85 (≠ Q94) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ R114) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A122) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ Y127) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ R129) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ E134) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G147) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D168) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
41% identity, 68% coverage: 30:218/279 of query aligns to 17:207/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
41% identity, 68% coverage: 30:218/279 of query aligns to 17:207/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S50), G38 (= G51), C39 (= C52), G40 (= G53), K41 (= K54), S42 (≠ T55), T43 (= T56), Q81 (= Q91), R128 (= R139), A132 (≠ Q143), S134 (= S145), G136 (= G147), Q137 (≠ M148), E158 (= E169), H191 (= H202)
- binding magnesium ion: S42 (≠ T55), Q81 (= Q91)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
41% identity, 68% coverage: 30:218/279 of query aligns to 17:207/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G51), C39 (= C52), G40 (= G53), K41 (= K54), S42 (≠ T55), T43 (= T56), R128 (= R139), S134 (= S145), Q137 (≠ M148)
- binding beryllium trifluoride ion: S37 (= S50), G38 (= G51), K41 (= K54), Q81 (= Q91), S134 (= S145), G136 (= G147), H191 (= H202)
- binding magnesium ion: S42 (≠ T55), Q81 (= Q91)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
41% identity, 68% coverage: 30:218/279 of query aligns to 17:207/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (= V30), G38 (= G51), C39 (= C52), G40 (= G53), K41 (= K54), S42 (≠ T55), T43 (= T56), R128 (= R139), A132 (≠ Q143), S134 (= S145), Q137 (≠ M148)
- binding tetrafluoroaluminate ion: S37 (= S50), G38 (= G51), K41 (= K54), Q81 (= Q91), S134 (= S145), G135 (= G146), G136 (= G147), E158 (= E169), H191 (= H202)
- binding magnesium ion: S42 (≠ T55), Q81 (= Q91)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
41% identity, 68% coverage: 30:218/279 of query aligns to 17:207/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (= V30), G38 (= G51), C39 (= C52), G40 (= G53), K41 (= K54), S42 (≠ T55), T43 (= T56), R128 (= R139), A132 (≠ Q143), S134 (= S145), Q137 (≠ M148)
- binding magnesium ion: S42 (≠ T55), Q81 (= Q91)
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
41% identity, 68% coverage: 30:218/279 of query aligns to 15:205/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S50), G36 (= G51), C37 (= C52), G38 (= G53), K39 (= K54), S40 (≠ T55), T41 (= T56), R126 (= R139), A130 (≠ Q143), S132 (= S145), G134 (= G147), Q135 (≠ M148)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
35% identity, 73% coverage: 15:217/279 of query aligns to 3:207/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y24), S38 (= S50), G39 (= G51), G41 (= G53), K42 (= K54), S43 (≠ T55), Q82 (= Q91), Q133 (= Q143), G136 (= G146), G137 (= G147), Q138 (≠ M148), H192 (= H202)
- binding magnesium ion: S43 (≠ T55), Q82 (= Q91)
8hprD Lpqy-sugabc in state 4 (see paper)
35% identity, 73% coverage: 15:217/279 of query aligns to 3:207/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y24), S38 (= S50), C40 (= C52), G41 (= G53), K42 (= K54), S43 (≠ T55), T44 (= T56), Q82 (= Q91), R129 (= R139), Q133 (= Q143), S135 (= S145), G136 (= G146), G137 (= G147), Q159 (≠ E169), H192 (= H202)
- binding magnesium ion: S43 (≠ T55), Q82 (= Q91)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
39% identity, 67% coverage: 32:217/279 of query aligns to 45:236/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
39% identity, 67% coverage: 32:217/279 of query aligns to 45:236/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
39% identity, 67% coverage: 32:217/279 of query aligns to 45:236/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S50), G62 (= G51), G64 (= G53), K65 (= K54), S66 (≠ T55), T67 (= T56), Q111 (= Q91), K161 (≠ H142), Q162 (= Q143), S164 (= S145), G166 (= G147), M167 (= M148), Q188 (≠ E169), H221 (= H202)
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
35% identity, 73% coverage: 15:217/279 of query aligns to 3:205/384 of 8hplC
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
36% identity, 73% coverage: 15:217/279 of query aligns to 2:218/232 of 1f3oA
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
40% identity, 73% coverage: 14:218/279 of query aligns to 3:212/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (≠ Y24), Q14 (≠ P25), T16 (≠ H28), V18 (= V30), S38 (= S50), G39 (= G51), C40 (= C52), G41 (= G53), K42 (= K54), T43 (= T55), T44 (= T56), R133 (= R139), E137 (≠ Q143), S139 (= S145), G141 (= G147), Q142 (≠ M148)
- binding calcium ion: T43 (= T55), Q86 (= Q91)
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
36% identity, 73% coverage: 15:217/279 of query aligns to 2:218/230 of 1l2tA
- binding adenosine-5'-triphosphate: Y11 (= Y24), S40 (= S50), G41 (= G51), S42 (≠ C52), G43 (= G53), K44 (= K54), S45 (≠ T55), T46 (= T56), F138 (vs. gap), Q145 (= Q143), S147 (= S145), G149 (= G147), Q150 (≠ M148), H204 (= H202)
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 82% coverage: 31:258/279 of query aligns to 16:238/348 of 3d31A
Sites not aligning to the query:
Query Sequence
>AO356_23545 FitnessBrowser__pseudo5_N2C3_1:AO356_23545
MPKTLPYPQPQADALTVDDISFSYPNGHRVFSSFSLNARPGEFVAILGPSGCGKTTLLNL
LSGFVQPQSGRITINQTAVRPERSELGYVFQAPQLFPWLSALENVRFGLRMSARTDEAQQ
RAQALQYLRLVGLENAAQRLPHQLSGGMQQRVSLARTLALEPSVLLMDEPFAALDAISRN
SMNEETLRIWAELGQTVLFITHDIDEAVFLADRVIVLNIAPGGIHSELEIHLPRPRSNLK
TRRLPAFLDYRNELMTRIAQVMDACDTTVHPTPRLELTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory