SitesBLAST
Comparing AO356_23595 FitnessBrowser__pseudo5_N2C3_1:AO356_23595 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
36% identity, 95% coverage: 10:250/254 of query aligns to 3:251/261 of 1g6kA
- active site: G18 (= G25), S145 (= S143), Y158 (= Y156), K162 (= K160)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S24), G18 (= G25), L19 (≠ I26), R39 (vs. gap), D65 (= D64), V66 (≠ I65), N92 (= N91), A93 (= A92), G94 (= G93), M143 (≠ I141), S145 (= S143), Y158 (= Y156), P188 (≠ V186), G189 (= G187), I191 (≠ V189), T193 (= T191)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
38% identity, 96% coverage: 8:250/254 of query aligns to 4:251/258 of 4wecA
- active site: G21 (= G25), S143 (= S143), Q154 (≠ A154), Y157 (= Y156), K161 (= K160)
- binding nicotinamide-adenine-dinucleotide: G17 (= G21), A19 (= A23), S20 (= S24), G21 (= G25), I22 (= I26), D41 (= D45), I42 (= I46), V61 (≠ L61), D62 (= D64), V63 (≠ I65), N89 (= N91), T141 (≠ I141), Y157 (= Y156), K161 (= K160), P187 (≠ V186), P189 (≠ D188), V190 (= V189)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
36% identity, 95% coverage: 10:250/254 of query aligns to 3:251/261 of P40288
- 11:35 (vs. 18:42, 36% identical) binding
- E96 (≠ I95) mutation E->A,G,K: Heat stable.
- D108 (= D107) mutation to N: Heat stable.
- V112 (≠ I111) mutation to A: Heat stable.
- E133 (≠ P132) mutation to K: Heat stable.
- V183 (= V181) mutation to I: Heat stable.
- P194 (≠ N192) mutation to Q: Heat stable.
- E210 (≠ G209) mutation to K: Heat stable.
- Y217 (≠ R216) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 93% coverage: 15:250/254 of query aligns to 8:253/255 of 5itvA
- active site: G18 (= G25), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G21), S17 (= S24), G18 (= G25), I19 (= I26), D38 (= D45), I39 (= I46), T61 (≠ A63), I63 (= I65), N89 (= N91), G91 (= G93), T139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (≠ V186), G185 (= G187), I186 (≠ V189), I187 (≠ V190)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 93% coverage: 15:250/254 of query aligns to 8:225/227 of 5itvD
- active site: G18 (= G25), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G21), S17 (= S24), G18 (= G25), I19 (= I26), D38 (= D45), I39 (= I46), T61 (≠ A63), D62 (= D64), I63 (= I65), N89 (= N91), T139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (≠ V186), G185 (= G187), I187 (≠ V189)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
37% identity, 94% coverage: 10:249/254 of query aligns to 1:237/239 of 4nbtA
- active site: G16 (= G25), S132 (= S143), Y145 (= Y156), K149 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), K15 (≠ S24), G16 (= G25), L17 (≠ I26), D36 (= D45), L37 (≠ I46), L52 (≠ A63), N53 (≠ D64), V54 (≠ I65), N80 (= N91), A81 (= A92), G82 (= G93), I130 (= I141), S132 (= S143), Y145 (= Y156), K149 (= K160), P177 (≠ V186), G178 (= G187), I180 (≠ V189), T182 (= T191)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
36% identity, 94% coverage: 11:250/254 of query aligns to 10:257/267 of 3ay6B
- active site: G24 (= G25), S151 (= S143), Y164 (= Y156), K168 (= K160)
- binding beta-D-glucopyranose: E102 (≠ I95), S151 (= S143), H153 (≠ A145), W158 (≠ F150), Y164 (= Y156), N202 (≠ L194), K205 (≠ V197)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G21), T23 (≠ S24), G24 (= G25), L25 (≠ I26), Y45 (vs. gap), D71 (= D64), V72 (≠ I65), N98 (= N91), A99 (= A92), G100 (= G93), V101 (≠ I94), M149 (≠ I141), S151 (= S143), Y164 (= Y156), K168 (= K160), P194 (≠ V186), G195 (= G187), M197 (≠ V189), T199 (= T191), P200 (≠ N192), I201 (= I193), N202 (≠ L194)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
38% identity, 93% coverage: 15:250/254 of query aligns to 6:246/248 of 6ixmC
- active site: G16 (= G25), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), S15 (= S24), G16 (= G25), I17 (= I26), D36 (= D45), I37 (= I46), A61 (= A63), D62 (= D64), T63 (≠ I65), N89 (= N91), A90 (= A92), M140 (≠ I141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (≠ V186), A186 (≠ G187), Y187 (≠ D188), I188 (≠ V189), L192 (≠ I193)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 94% coverage: 12:249/254 of query aligns to 6:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G21), S17 (≠ A23), R18 (≠ S24), I20 (= I26), T40 (vs. gap), N62 (≠ D64), V63 (≠ I65), N89 (= N91), A90 (= A92), I92 (= I94), V139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (≠ V186), G185 (= G187), I187 (≠ V189), T189 (= T191), M191 (≠ I193)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 94% coverage: 12:249/254 of query aligns to 6:240/243 of 4i08A
- active site: G19 (= G25), N113 (= N115), S141 (= S143), Q151 (≠ I153), Y154 (= Y156), K158 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G21), S17 (≠ A23), R18 (≠ S24), I20 (= I26), T40 (vs. gap), N62 (≠ D64), V63 (≠ I65), N89 (= N91), A90 (= A92), G140 (≠ A142), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (≠ V186), G185 (= G187), T189 (= T191)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
36% identity, 93% coverage: 15:251/254 of query aligns to 6:239/240 of 4dmmB
- active site: G16 (= G25), S142 (= S143), Q152 (≠ I153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (≠ A23), R15 (≠ S24), G16 (= G25), I17 (= I26), A37 (≠ I46), S38 (≠ N47), S39 (≠ P48), A62 (= A63), D63 (= D64), V64 (≠ I65), N90 (= N91), A91 (= A92), L113 (≠ V114), I140 (= I141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (≠ V186), G186 (= G187), I188 (≠ V189), T190 (= T191), M192 (≠ I193)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 93% coverage: 13:249/254 of query aligns to 4:241/244 of P0AEK2
- GASR 12:15 (≠ GAAS 21:24) binding
- T37 (vs. gap) binding
- NV 59:60 (≠ DI 64:65) binding
- N86 (= N91) binding
- Y151 (= Y156) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YTASK 156:160) binding
- A154 (≠ S159) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K160) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V189) binding
- E233 (≠ A241) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
39% identity, 94% coverage: 14:252/254 of query aligns to 5:239/240 of 2d1yA
- active site: G16 (= G25), S135 (= S143), N145 (≠ I153), Y148 (= Y156), K152 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), R15 (≠ S24), I17 (= I26), D36 (= D45), L37 (≠ I46), R38 (≠ N47), V55 (≠ A63), D56 (= D64), L57 (≠ I65), N83 (= N91), A84 (= A92), A85 (≠ G93), I86 (= I94), V133 (≠ I141), S135 (= S143), Y148 (= Y156), K152 (= K160), P178 (≠ V186), G179 (= G187), I181 (≠ V189), T183 (= T191), A185 (≠ I193), V186 (≠ L194)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 93% coverage: 13:249/254 of query aligns to 3:240/243 of 1q7bA
- active site: G15 (= G25), E101 (≠ D107), S137 (= S143), Q147 (≠ I153), Y150 (= Y156), K154 (= K160)
- binding calcium ion: E232 (≠ A241), T233 (≠ V242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G21), S13 (≠ A23), R14 (≠ S24), T36 (vs. gap), N58 (≠ D64), V59 (≠ I65), N85 (= N91), A86 (= A92), G87 (= G93), I88 (= I94), S137 (= S143), Y150 (= Y156), K154 (= K160), P180 (≠ V186), G181 (= G187), I183 (≠ V189)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 93% coverage: 13:249/254 of query aligns to 4:241/244 of 6t77A
- active site: G16 (= G25), S138 (= S143), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (≠ A23), R15 (≠ S24), T37 (vs. gap), L58 (≠ A63), N59 (≠ D64), V60 (≠ I65), A87 (= A92), G88 (= G93), I89 (= I94)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 93% coverage: 13:249/254 of query aligns to 4:241/244 of P0A2C9
- M125 (= M130) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A231) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S232) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 12:248/254 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G25), S142 (= S143), I152 (= I153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ I214), R211 (≠ G215), R212 (= R216)
- binding bicarbonate ion: I92 (= I94), G94 (≠ I96), R109 (= R110), R179 (= R180), S228 (= S232)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), G14 (≠ A23), N15 (≠ S24), G16 (= G25), I17 (= I26), D36 (= D45), I37 (= I46), D62 (= D64), T63 (≠ I65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (= I141), Y155 (= Y156), K159 (= K160), P185 (≠ V186), A186 (≠ G187), I188 (≠ V189), T190 (= T191)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 12:248/254 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G25), S142 (= S143), I152 (= I153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I94), S93 (≠ I95), G94 (≠ I96), E95 (≠ N97), T97 (≠ K98), E101 (≠ D102), T103 (= T104), Q106 (≠ D107), R109 (= R110), S175 (≠ E176), G177 (= G178)
- binding magnesium ion: S237 (≠ A241), Y238 (≠ V242)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), G14 (≠ A23), N15 (≠ S24), G16 (= G25), I17 (= I26), D36 (= D45), I37 (= I46), W41 (≠ L53), D62 (= D64), T63 (≠ I65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (= I141), Y155 (= Y156), K159 (= K160), P185 (≠ V186), I188 (≠ V189), T190 (= T191)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 12:248/254 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G25), S142 (= S143), I152 (= I153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S24), G16 (= G25), I17 (= I26), N89 (= N91), G91 (= G93), Y155 (= Y156), P185 (≠ V186), A186 (≠ G187)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 94% coverage: 12:249/254 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G25), S142 (= S143), Q152 (≠ I153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (≠ A23), R15 (≠ S24), G16 (= G25), I17 (= I26), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (vs. gap), N63 (≠ D64), V64 (≠ I65), N90 (= N91), A91 (= A92), I93 (= I94), I113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (≠ V186), I188 (≠ V189), T190 (= T191)
Query Sequence
>AO356_23595 FitnessBrowser__pseudo5_N2C3_1:AO356_23595
MTDFQHSIPHEVQGKVALVTGAASGIGKAIALLLHVRGAKVIAEDINPAVHELARPGLVP
LEADITADGAAERAVGLAVEQFGRLDILVNNAGIIINKLVIDMTRQDWERIQAVNATAAF
LHSREAVKAMMPNKAGAIVNIASYASYFAFPTIAAYTASKGALAQLTRTLALEVIEHGIR
VNAIGVGDVVTNILNDVVEDGPAFLAQHGEAAPIGRAAQPEEIAEVVAFLASDRASFVVG
AVVMADGGMTVTAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory