SitesBLAST
Comparing AO356_24000 FitnessBrowser__pseudo5_N2C3_1:AO356_24000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
47% identity, 99% coverage: 1:469/474 of query aligns to 2:465/465 of 3pm9A
- active site: A149 (= A149), L159 (≠ N159)
- binding flavin-adenine dinucleotide: P69 (≠ V67), Q70 (= Q68), G71 (= G69), G72 (= G70), N73 (= N71), T74 (= T72), G75 (= G73), L76 (= L74), G79 (= G77), Q80 (≠ A78), L91 (= L91), L133 (= L133), G134 (= G134), A135 (= A135), C139 (= C139), T140 (= T140), G142 (= G142), G143 (= G143), S146 (≠ G146), T147 (= T147), A149 (= A149), G150 (= G150), E200 (= E200), G201 (= G201), I205 (= I205), I206 (= I206), E423 (= E427)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
39% identity, 90% coverage: 43:469/474 of query aligns to 51:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), H423 (= H428)
- binding flavin-adenine dinucleotide: P75 (≠ V67), Q76 (= Q68), G77 (= G69), G78 (= G70), N79 (= N71), T80 (= T72), G81 (= G73), M82 (≠ L74), G85 (= G77), S86 (≠ A78), L139 (= L133), G140 (= G134), A141 (= A135), C145 (= C139), G149 (= G143), N150 (= N144), A152 (≠ G146), T153 (= T147), G157 (= G151), G207 (= G201), I212 (= I206), E422 (= E427), N459 (= N464)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
39% identity, 90% coverage: 43:469/474 of query aligns to 51:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ V67), G77 (= G69), G78 (= G70), N79 (= N71), T80 (= T72), G81 (= G73), G85 (= G77), S86 (≠ A78), L139 (= L133), G140 (= G134), A141 (= A135), C145 (= C139), H146 (≠ T140), G148 (= G142), G149 (= G143), N150 (= N144), A152 (≠ G146), T153 (= T147), A155 (= A149), E206 (= E200), G207 (= G201), I211 (= I205), I212 (= I206), E422 (= E427), N459 (= N464)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), H423 (= H428)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
39% identity, 90% coverage: 43:469/474 of query aligns to 51:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (≠ V67), G77 (= G69), G78 (= G70), N79 (= N71), T80 (= T72), G81 (= G73), G85 (= G77), S86 (≠ A78), L139 (= L133), G140 (= G134), A141 (= A135), C145 (= C139), H146 (≠ T140), G149 (= G143), N150 (= N144), A152 (≠ G146), T153 (= T147), A155 (= A149), G157 (= G151), E206 (= E200), G207 (= G201), I211 (= I205), I212 (= I206), E422 (= E427), N459 (= N464)
- binding d-malate: M82 (≠ L74), R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), E422 (= E427), H423 (= H428)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
Sites not aligning to the query:
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
39% identity, 90% coverage: 43:469/474 of query aligns to 51:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), N390 (= N390), H423 (= H428)
- binding flavin-adenine dinucleotide: P75 (≠ V67), G77 (= G69), G78 (= G70), N79 (= N71), T80 (= T72), G81 (= G73), M82 (≠ L74), G85 (= G77), S86 (≠ A78), L139 (= L133), G140 (= G134), A141 (= A135), C145 (= C139), G149 (= G143), N150 (= N144), A152 (≠ G146), T153 (= T147), A155 (= A149), G157 (= G151), G207 (= G201), I212 (= I206), E422 (= E427), H423 (= H428)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
39% identity, 90% coverage: 43:469/474 of query aligns to 52:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ V67), G78 (= G69), G79 (= G70), N80 (= N71), T81 (= T72), G82 (= G73), M83 (≠ L74), G86 (= G77), S87 (≠ A78), L140 (= L133), A142 (= A135), C146 (= C139), H147 (≠ T140), G150 (= G143), N151 (= N144), A153 (≠ G146), T154 (= T147), G208 (= G201), I212 (= I205), I213 (= I206), E423 (= E427), N460 (= N464)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
39% identity, 90% coverage: 43:469/474 of query aligns to 104:517/521 of Q8N465
- S109 (≠ T48) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V66) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G70) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L88) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M94) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (= C113) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P130) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ G146) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A172) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G174) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S320) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R331) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S335) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ N344) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K346) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ D364) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ V374) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H381) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G383) to V: slight reduction in catalytic activity
- N439 (= N386) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H388) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N390) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V391) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ V399) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E427) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H428) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G429) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 95% coverage: 19:469/474 of query aligns to 48:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
34% identity, 98% coverage: 9:471/474 of query aligns to 14:466/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (= V67), G75 (= G69), S76 (≠ G70), G77 (≠ N71), T78 (= T72), G79 (= G73), L80 (= L74), A83 (≠ G77), C84 (≠ A78), P137 (≠ L133), G138 (= G134), E139 (= E136), A142 (≠ C139), T143 (= T140), G146 (= G143), N147 (= N144), S149 (≠ G146), T150 (= T147), A152 (= A149), G153 (= G150), E203 (= E200), G204 (= G201), I209 (= I206), E422 (= E427), H423 (= H428)
- binding fe (iii) ion: H377 (= H381), H384 (= H388), E422 (= E427)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 90% coverage: 42:469/474 of query aligns to 43:456/459 of P9WIT1
- K354 (≠ A358) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 99% coverage: 1:469/474 of query aligns to 1:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L74), R317 (= R331), W321 (vs. gap), H368 (= H381), H375 (= H388), H413 (= H428)
- binding flavin-adenine dinucleotide: P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), W321 (vs. gap), Y322 (vs. gap), E412 (= E427), H413 (= H428), N449 (= N464)
- binding manganese (ii) ion: H368 (= H381), H375 (= H388), E412 (= E427)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 99% coverage: 1:469/474 of query aligns to 1:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R331), W322 (vs. gap), H369 (= H381), H376 (= H388), H414 (= H428)
- binding flavin-adenine dinucleotide: P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E427), N450 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 99% coverage: 1:469/474 of query aligns to 1:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R331), H369 (= H381), H376 (= H388), H414 (= H428)
- binding flavin-adenine dinucleotide: P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E427), H414 (= H428), N450 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 99% coverage: 1:469/474 of query aligns to 1:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E427), H414 (= H428), N450 (= N464)
- binding lactic acid: R318 (= R331), H369 (= H381), H376 (= H388), H414 (= H428)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 99% coverage: 1:469/474 of query aligns to 1:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ K31), P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), W323 (vs. gap), E414 (= E427), H415 (= H428), N451 (= N464)
- binding manganese (ii) ion: H370 (= H381), H377 (= H388), E414 (= E427)
- binding pyruvic acid: R319 (= R331), H370 (= H381), H377 (= H388), H415 (= H428)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
30% identity, 99% coverage: 1:469/474 of query aligns to 1:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ K31), P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E427), H414 (= H428), N450 (= N464)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R331), H369 (= H381), H376 (= H388), H414 (= H428)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 99% coverage: 1:469/474 of query aligns to 1:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R331), W322 (vs. gap), H369 (= H381), H376 (= H388), H413 (= H428)
- binding flavin-adenine dinucleotide: E32 (≠ K31), P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E412 (= E427), H413 (= H428), N449 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E427)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 99% coverage: 1:469/474 of query aligns to 1:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R331), W322 (vs. gap), S336 (≠ K346), H369 (= H381), H376 (= H388), H413 (= H428)
- binding flavin-adenine dinucleotide: P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), E412 (= E427), N449 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E427)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
28% identity, 99% coverage: 1:469/474 of query aligns to 1:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), Y324 (vs. gap), H370 (= H381), E414 (= E427), N451 (= N464)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R331), W323 (vs. gap), H415 (= H428)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
28% identity, 99% coverage: 1:469/474 of query aligns to 1:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R331), W323 (vs. gap), H370 (= H381), H415 (= H428)
- binding flavin-adenine dinucleotide: P68 (≠ V67), G70 (= G69), T71 (≠ G70), G72 (≠ N71), T73 (= T72), G74 (= G73), G78 (= G77), V79 (≠ A78), L90 (= L91), P132 (≠ L133), G133 (= G134), A134 (= A135), G140 (= G143), M141 (≠ N144), A143 (≠ G146), T144 (= T147), A146 (= A149), S147 (≠ G150), E200 (= E200), G201 (= G201), I206 (= I206), H370 (= H381), E414 (= E427), N451 (= N464)
Query Sequence
>AO356_24000 FitnessBrowser__pseudo5_N2C3_1:AO356_24000
MSQSLFLTLQALVGAKHVQGSEDAAPYLTDKQGRYVGQVIAAVHPASTEEVAAVVRACAA
TDTPVVVQGGNTGLIGGATPDSSGRAMLLLLDRMNRVRAVDTDNDTLTVEAGCILQTVQD
VAREAGRLFPLSLGAEGSCTLGGNLGTNAGGTAVLRYGNTRELTLGLEVVTARGEVWDGL
RGLRKDNTGYDLRDLFIGSEGTLGIITAATLKLFPLPKAQATALLAFDSLEQAVALLSHA
RAGFGASLTAFELLSAECLALLREQFPDGPRPFASARQPWFALLELSDNHSESHAREVFE
QVLGEAFEQHLLADALIAESLVQSQAFWQLRENMSDAQKRAGRNMKHDISVPISQVVAFV
AHTDALLQEQFPGVRHYTFGHLGDGNLHYNVAHPLDSTVDAHMGHYAALSRLVHDSAHAH
GGSISAEHGIGQRKVNELGRYKSTVELDLMHRIKQALDPRNLLNPGKVLEQIQP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory