Comparing AO356_24105 FitnessBrowser__pseudo5_N2C3_1:AO356_24105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
64% identity, 97% coverage: 8:305/306 of query aligns to 3:300/301 of P13703
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
53% identity, 94% coverage: 9:297/306 of query aligns to 33:321/325 of P35914
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
53% identity, 94% coverage: 9:297/306 of query aligns to 6:294/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
53% identity, 94% coverage: 9:297/306 of query aligns to 6:294/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
53% identity, 94% coverage: 9:297/306 of query aligns to 6:294/296 of 3mp5B
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
53% identity, 94% coverage: 9:297/306 of query aligns to 78:366/370 of Q8TB92
Sites not aligning to the query:
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
49% identity, 90% coverage: 9:284/306 of query aligns to 4:279/283 of 1ydnA
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
32% identity, 97% coverage: 1:297/306 of query aligns to 1:295/305 of 6ndsA
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
22% identity, 77% coverage: 5:240/306 of query aligns to 18:247/399 of 6ktqA
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
22% identity, 91% coverage: 9:287/306 of query aligns to 85:370/503 of Q9FN52
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
22% identity, 89% coverage: 17:287/306 of query aligns to 12:277/308 of 3rmjB
Q53WI0 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39; EC 4.1.3.43 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
27% identity, 44% coverage: 148:282/306 of query aligns to 139:268/347 of Q53WI0
Sites not aligning to the query:
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
23% identity, 89% coverage: 17:287/306 of query aligns to 15:280/517 of Q9JZG1
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
33% identity, 25% coverage: 163:240/306 of query aligns to 145:221/370 of 3mi3A
Sites not aligning to the query:
3ivsA Homocitrate synthase lys4 (see paper)
33% identity, 25% coverage: 163:240/306 of query aligns to 143:219/364 of 3ivsA
Sites not aligning to the query:
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
33% identity, 25% coverage: 163:240/306 of query aligns to 179:255/418 of Q9Y823
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
33% identity, 25% coverage: 163:240/306 of query aligns to 174:250/400 of 3ivtB
Sites not aligning to the query:
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
30% identity, 37% coverage: 159:272/306 of query aligns to 157:263/453 of 2nx9B
Sites not aligning to the query:
>AO356_24105 FitnessBrowser__pseudo5_N2C3_1:AO356_24105
MNSHLDLSVRLVEVGARDGLQNENRTLAPAIRVELLKKLANAGLRTLEAGAFVSERWVPH
MAGSGDVFKALPDLPDVTWTALVPNARGLEEALAAGCREVAVFAAASEAFSQKNINCSIA
ESLERFEAVMVRARDADVRVRGYVSCVMGCPFTGHVKPETVAAVSAALYGMGCYEISLGD
TIGTGTPAATKALLDACTRVVPVNALAGHFHDTYGMAIANIHTALGMGVRVFDSSVAGLG
GCPYSPGATGNVATEDVLYLLDGLGIKHGVDLDAVVDAGEFIDAHLGRETASRVARALLA
KRRREA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory