Comparing AO356_25850 FitnessBrowser__pseudo5_N2C3_1:AO356_25850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
72% identity, 98% coverage: 4:165/165 of query aligns to 2:164/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
47% identity, 65% coverage: 56:162/165 of query aligns to 55:160/164 of 2ge3A
Sites not aligning to the query:
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
33% identity, 77% coverage: 38:164/165 of query aligns to 44:170/171 of 2i79A
Sites not aligning to the query:
P0A951 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Escherichia coli (strain K12) (see 4 papers)
26% identity, 98% coverage: 2:162/165 of query aligns to 3:163/186 of P0A951
Sites not aligning to the query:
3wr7A Crystal structure of spermidine acetyltransferase from escherichia coli (see paper)
26% identity, 96% coverage: 4:162/165 of query aligns to 1:159/170 of 3wr7A
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
25% identity, 98% coverage: 4:165/165 of query aligns to 2:164/170 of 6e1xA
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
25% identity, 98% coverage: 4:165/165 of query aligns to 2:164/170 of 4r87A
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
25% identity, 98% coverage: 4:165/165 of query aligns to 2:164/170 of 4r57A
4nczA Spermidine n-acetyltransferase from vibrio cholerae in complex with 2- [n-cyclohexylamino]ethane sulfonate. (see paper)
25% identity, 98% coverage: 4:165/165 of query aligns to 2:164/170 of 4nczA
4mi4A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine (see paper)
25% identity, 98% coverage: 4:165/165 of query aligns to 2:164/170 of 4mi4A
4mhdA Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine (see paper)
25% identity, 98% coverage: 4:165/165 of query aligns to 2:164/170 of 4mhdA
6e1xC Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
25% identity, 98% coverage: 4:165/165 of query aligns to 6:168/176 of 6e1xC
6cx8A Crystal structure of spermidine/spermine n-acetyltransferase speg from vibrio cholerae in complex with manganese ions.
25% identity, 98% coverage: 4:165/165 of query aligns to 3:165/173 of 6cx8A
Q9KL03 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
25% identity, 98% coverage: 4:165/165 of query aligns to 3:165/173 of Q9KL03
5cnpB X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae. (see paper)
25% identity, 98% coverage: 4:165/165 of query aligns to 2:164/171 of 5cnpB
P0A948 [Ribosomal protein uS5]-alanine N-acetyltransferase; Acetylating enzyme for N-terminal of ribosomal protein S5; EC 2.3.1.267 from Escherichia coli (strain K12) (see paper)
30% identity, 73% coverage: 43:162/165 of query aligns to 59:184/194 of P0A948
Sites not aligning to the query:
4r9mA Crystal structure of spermidine n-acetyltransferase from escherichia coli (see paper)
26% identity, 82% coverage: 27:162/165 of query aligns to 25:160/169 of 4r9mA
6d72B Crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.
23% identity, 96% coverage: 4:162/165 of query aligns to 6:164/176 of 6d72B
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
29% identity, 93% coverage: 12:164/165 of query aligns to 10:164/165 of 4jwpA
6yzzA Arabidopsis thaliana naa50 in complex with accoa (see paper)
36% identity, 41% coverage: 85:151/165 of query aligns to 73:138/151 of 6yzzA
>AO356_25850 FitnessBrowser__pseudo5_N2C3_1:AO356_25850
MSESSITLARFTEAHIAGVTALYNDPAVTRQVLQMPFQSTEVWRKRLATDDERLLKLVAL
HTGDVIGNLGLEQFSRVRRAHCGSLGMGVAVAWQGKGVGSMLLAAALDVADNWMNLRRVE
LTVYADNEAAIGLYRKFGFESEGLMRDYAVRDGRWVDTLAMARLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory