Comparing AO356_26030 FitnessBrowser__pseudo5_N2C3_1:AO356_26030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 83% coverage: 23:286/320 of query aligns to 16:280/304 of 1wwkA
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
29% identity, 85% coverage: 40:311/320 of query aligns to 36:315/334 of 5aovA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 33:285/303 of 6plgA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 30:282/299 of 6rj2A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 34:286/305 of 6plfA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 32:284/299 of 6cwaA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 32:284/297 of 6rj3A
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 34:286/306 of 7dkmA
Sites not aligning to the query:
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 33:285/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 33:285/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 79% coverage: 40:291/320 of query aligns to 33:285/302 of 6rihA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 79% coverage: 39:291/320 of query aligns to 37:290/533 of O43175
Sites not aligning to the query:
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
39% identity, 64% coverage: 86:291/320 of query aligns to 69:276/292 of 6plfB
7cvpA The crystal structure of human phgdh from biortus.
39% identity, 58% coverage: 107:291/320 of query aligns to 54:239/254 of 7cvpA
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
36% identity, 78% coverage: 39:286/320 of query aligns to 32:280/525 of 3ddnB
Sites not aligning to the query:
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
34% identity, 85% coverage: 39:311/320 of query aligns to 31:304/526 of 3dc2A
Sites not aligning to the query:
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
39% identity, 58% coverage: 107:291/320 of query aligns to 6:191/195 of 5ofwA
Sites not aligning to the query:
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
39% identity, 58% coverage: 107:291/320 of query aligns to 6:191/195 of 5ofvA
Sites not aligning to the query:
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
39% identity, 58% coverage: 107:291/320 of query aligns to 6:191/195 of 5ofmA
Sites not aligning to the query:
5nzqA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-(1,3-oxazol-5-yl)aniline. (see paper)
39% identity, 58% coverage: 107:291/320 of query aligns to 6:191/195 of 5nzqA
Sites not aligning to the query:
>AO356_26030 FitnessBrowser__pseudo5_N2C3_1:AO356_26030
MAVQIAVIDDWQDVARGVVDWSVLDGVGQVTFLHDYPADRDTLAERLQHFEVICVMRERT
VFDEGLLRRLPNLKLLLTGGMRNAALDLKAAAELGIQVCGTDSYKHAAPELTWTLIMALA
RNLVQEANALRAGLWQQGLGGDLHGKTLAILGLGSIGTRVAQFGQVFGMRVIAWSQNLSA
ERAAEVGVTYVSKQALFEQADILSIHLVLGERTRGLVDAQALGWMKPEALLVNTSRGPIV
DEAALIDALRHRRLAGAALDVFAQEPLPLAHPFRTLENVLATPHVGYVSRQNYQQFYSLM
IEDLLAWAAGQPIRLLTPPG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory