SitesBLAST
Comparing AO356_26320 FitnessBrowser__pseudo5_N2C3_1:AO356_26320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
58% identity, 100% coverage: 1:323/323 of query aligns to 2:321/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (= N32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (= D61), L62 (≠ V62), L83 (= L83), A84 (= A84), A85 (= A85), A118 (= A125), Y145 (= Y152), K149 (= K156), F172 (= F179), F173 (= F180), T174 (= T181), V175 (= V182), R181 (= R188)
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
56% identity, 100% coverage: 1:322/323 of query aligns to 2:304/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (= N32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (= D61), L62 (≠ V62), L83 (= L83), A84 (= A84), A85 (= A85), A123 (= A125), Y150 (= Y152), K154 (= K156), F177 (= F179), V180 (= V182), R186 (= R188), M189 (= M191)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
33% identity, 100% coverage: 1:322/323 of query aligns to 1:315/321 of 6zllA
- active site: T126 (≠ S127), S127 (= S128), S128 (= S129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ V62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (≠ S127), Y149 (= Y152), K153 (= K156), Y176 (≠ F179), V179 (= V182), R185 (= R188), M188 (= M191)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A87), V87 (= V89), R88 (= R90), T126 (≠ S127), S127 (= S128), Y149 (= Y152), T178 (= T181), R185 (= R188), A189 (= A192), R192 (≠ K195), T204 (≠ D207), F206 (≠ Y209), Q211 (≠ M214), R213 (= R216), I250 (≠ L257), E276 (≠ D283)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
33% identity, 99% coverage: 1:321/323 of query aligns to 1:314/314 of 6zldA
- active site: T126 (≠ S127), S127 (= S128), S128 (= S129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ V62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (≠ S127), K153 (= K156), Y176 (≠ F179), T178 (= T181), R185 (= R188), M188 (= M191)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A87), R88 (= R90), T126 (≠ S127), S127 (= S128), S128 (= S129), Y149 (= Y152), F177 (= F180), T178 (= T181), R185 (= R188), M188 (= M191), A189 (= A192), R192 (≠ K195), T204 (≠ D207), F206 (≠ Y209), Q211 (≠ M214), R213 (= R216), I250 (≠ L257), E276 (≠ D283)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
33% identity, 99% coverage: 1:321/323 of query aligns to 1:314/314 of 6zl6A
- active site: T126 (≠ S127), S127 (= S128), S128 (= S129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ V62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (≠ S127), K153 (= K156), Y176 (≠ F179), T178 (= T181), V179 (= V182), R185 (= R188), M188 (= M191)
- binding uridine-5'-diphosphate: T178 (= T181), A189 (= A192), R192 (≠ K195), T204 (≠ D207), F206 (≠ Y209), Q211 (≠ M214), R213 (= R216), I250 (≠ L257), E276 (≠ D283)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
33% identity, 99% coverage: 1:321/323 of query aligns to 1:314/314 of 6zljA
- active site: T126 (≠ S127), S127 (= S128), S128 (= S129), F149 (≠ Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ L33), I35 (≠ N34), K43 (= K42), D62 (= D61), I63 (≠ V62), L81 (= L83), A82 (= A84), A83 (= A85), I124 (≠ A125), T126 (≠ S127), K153 (= K156), Y176 (≠ F179), T178 (= T181), V179 (= V182), R185 (= R188), M188 (= M191)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A87), R88 (= R90), T126 (≠ S127), S127 (= S128), S128 (= S129), F149 (≠ Y152), F177 (= F180), T178 (= T181), R185 (= R188), M188 (= M191), A189 (= A192), R192 (≠ K195), T204 (≠ D207), F206 (≠ Y209), Q211 (≠ M214), R213 (= R216), I250 (≠ L257), E276 (≠ D283)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
32% identity, 97% coverage: 4:317/323 of query aligns to 19:335/340 of 1sb9A
- active site: S141 (= S127), S142 (= S128), S143 (= S129), Y165 (= Y152), K169 (= K156), N203 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G22 (= G7), G25 (= G10), F26 (= F11), I27 (= I12), D46 (= D31), N47 (= N32), F48 (≠ L33), T50 (≠ S35), G51 (≠ Y36), D77 (= D61), I78 (≠ V62), Q97 (≠ L83), A99 (= A85), T116 (≠ S102), A139 (= A125), A140 (≠ S126), Y165 (= Y152), K169 (= K156), Y192 (≠ F179), N194 (≠ T181), V195 (= V182)
- binding uridine-5'-diphosphate-glucose: S141 (= S127), Y165 (= Y152), N194 (≠ T181), A208 (vs. gap), V209 (vs. gap), W213 (≠ F196), Y224 (≠ D207), I225 (≠ L208), N226 (≠ Y209), L270 (= L257), R298 (≠ Q280), D301 (= D283)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
32% identity, 97% coverage: 4:317/323 of query aligns to 20:336/341 of 1sb8A
- active site: S142 (= S127), S143 (= S128), S144 (= S129), Y166 (= Y152), K170 (= K156), N204 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), F49 (≠ L33), T51 (≠ S35), G52 (≠ Y36), D78 (= D61), I79 (≠ V62), Q98 (≠ L83), A100 (= A85), T117 (≠ S102), A140 (= A125), A141 (≠ S126), Y166 (= Y152), K170 (= K156), Y193 (≠ F179), N195 (≠ T181), V196 (= V182)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G88), S142 (= S127), S143 (= S128), S144 (= S129), Y166 (= Y152), N195 (≠ T181), A209 (vs. gap), V210 (vs. gap), W214 (≠ F196), Y225 (≠ D207), I226 (≠ L208), N227 (≠ Y209), R234 (= R216), L271 (= L257), R299 (≠ Q280), D302 (= D283), S306 (≠ T287)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
31% identity, 98% coverage: 1:318/323 of query aligns to 1:305/309 of 4zrnA
- active site: T117 (≠ S127), G119 (≠ S128), A120 (≠ S129), Y143 (= Y152), K147 (= K156), Y181 (≠ W186), G185 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), S34 (≠ N34), S35 (= S35), G36 (≠ Y36), S51 (≠ D61), I52 (≠ V62), L73 (= L83), A74 (= A84), A75 (= A85), T92 (≠ S102), S115 (≠ A125), S116 (= S126), Y143 (= Y152), K147 (= K156), Y170 (≠ F179), V173 (= V182)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S127), G119 (≠ S128), A120 (≠ S129), Y143 (= Y152), N172 (≠ T181), G185 (≠ D190), V186 (≠ M191), H201 (≠ D207), F203 (≠ Y209), Y208 (≠ M214), R210 (= R216), V244 (≠ L257), R267 (≠ Q280), D270 (= D283)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 97% coverage: 4:317/323 of query aligns to 20:331/336 of 3ruhA
- active site: S142 (= S127), S143 (= S128), S144 (= S129), Y166 (= Y152), K170 (= K156), N204 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ S35), G52 (≠ Y36), D78 (= D61), I79 (≠ V62), Q98 (≠ L83), A99 (= A84), A100 (= A85), T117 (≠ S102), A140 (= A125), A141 (≠ S126), S142 (= S127), Y166 (= Y152), K170 (= K156), Y193 (≠ F179), V196 (= V182)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A87), S103 (≠ G88), S142 (= S127), S143 (= S128), S144 (= S129), Y166 (= Y152), Y193 (≠ F179), N195 (≠ T181), A209 (vs. gap), V210 (vs. gap), K213 (= K195), W214 (≠ F196), Y225 (≠ D207), I226 (≠ L208), N227 (≠ Y209), R234 (= R216), L271 (= L257), R294 (≠ Q280), D297 (= D283), V298 (= V284), S301 (≠ T287)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 97% coverage: 4:317/323 of query aligns to 20:331/336 of 3rufA
- active site: S142 (= S127), S143 (= S128), S144 (= S129), Y166 (= Y152), K170 (= K156), N204 (≠ D190)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ S35), G52 (≠ Y36), D78 (= D61), I79 (≠ V62), Q98 (≠ L83), A99 (= A84), A100 (= A85), T117 (≠ S102), A140 (= A125), Y166 (= Y152), K170 (= K156), Y193 (≠ F179), V196 (= V182)
- binding uridine-5'-diphosphate: N195 (≠ T181), A209 (vs. gap), V210 (vs. gap), K213 (= K195), W214 (≠ F196), Y225 (≠ D207), I226 (≠ L208), N227 (≠ Y209), R234 (= R216), L271 (= L257), R294 (≠ Q280), D297 (= D283)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
30% identity, 97% coverage: 4:317/323 of query aligns to 20:331/336 of 3lu1A
- active site: S142 (= S127), S143 (= S128), S144 (= S129), Y166 (= Y152), K170 (= K156), N204 (≠ D190)
- binding glycine: Q135 (≠ A120), K187 (≠ P173)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ S35), G52 (≠ Y36), D78 (= D61), I79 (≠ V62), Q98 (≠ L83), A99 (= A84), A100 (= A85), A140 (= A125), A141 (≠ S126), S142 (= S127), Y166 (= Y152), K170 (= K156), Y193 (≠ F179), N195 (≠ T181)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G88), S142 (= S127), S143 (= S128), S144 (= S129), Y166 (= Y152), N195 (≠ T181), V210 (vs. gap), W214 (≠ F196), Y225 (≠ D207), I226 (≠ L208), N227 (≠ Y209), R234 (= R216), L271 (= L257), R294 (≠ Q280), D297 (= D283)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
30% identity, 97% coverage: 4:317/323 of query aligns to 23:339/345 of Q7BJX9
- GVAGFI 26:31 (≠ GAAGFI 7:12) binding
- DNFSTG 50:55 (≠ DNLNSY 31:36) binding
- DI 81:82 (≠ DV 61:62) binding
- QAA 101:103 (≠ LAA 83:85) binding
- T120 (≠ S102) binding
- SS 145:146 (= SS 127:128) binding
- S147 (= S129) mutation to T: No effect on epimerase activity.
- Y169 (= Y152) binding
- K173 (= K156) binding
- YFN 196:198 (≠ FFT 179:181) binding
- V199 (= V182) binding
- VIPK 213:216 (≠ ---K 195) binding
- YIN 228:230 (≠ DLY 207:209) binding
- S236 (= S215) mutation to G: No effect on epimerase activity.
- R237 (= R216) binding
- R271 (≠ P254) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ QAGD 280:283) binding
- R307 (≠ V285) mutation to A: No effect on epimerase activity.
- H308 (≠ D286) mutation to A: No effect on epimerase activity.
- S309 (≠ T287) mutation to Y: Abolishes epimerase activity.
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
30% identity, 99% coverage: 3:323/323 of query aligns to 12:323/330 of 6pmhA
- active site: S127 (= S127), C129 (vs. gap), G130 (≠ S129), Y153 (= Y152), K157 (= K156)
- binding adenosine monophosphate: G16 (= G7), G19 (= G10), D40 (= D31), N41 (= N32), S43 (≠ N34), S44 (= S35), S45 (≠ Y36), D62 (= D61), I63 (≠ V62), A84 (= A84), F87 (≠ A87), R194 (≠ T197)
- binding uridine-5'-diphosphate: C129 (vs. gap), N182 (≠ T181), N195 (≠ D198), V196 (≠ A199), F200 (vs. gap), P211 (≠ D207), I212 (≠ L208), T213 (≠ Y209), R220 (= R216), V256 (≠ L257), R279 (≠ Q280)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
30% identity, 99% coverage: 3:323/323 of query aligns to 18:329/336 of 6pnlA
- active site: S133 (= S127), C135 (vs. gap), G136 (≠ S129), Y159 (= Y152), K163 (= K156)
- binding nicotinamide-adenine-dinucleotide: G22 (= G7), G25 (= G10), C26 (≠ F11), D46 (= D31), N47 (= N32), L48 (= L33), S49 (≠ N34), S50 (= S35), S51 (≠ Y36), D68 (= D61), I69 (≠ V62), L89 (= L83), A91 (= A85), F93 (≠ A87), V108 (≠ S102), S131 (≠ A125), S133 (= S127), Y159 (= Y152), K163 (= K156), F186 (= F179), N188 (≠ T181), V189 (= V182), R200 (≠ T197)
- binding uridine-5'-diphosphate: N188 (≠ T181), N201 (≠ D198), V202 (≠ A199), F206 (vs. gap), P217 (≠ D207), I218 (≠ L208), T219 (≠ Y209), R226 (= R216), V262 (≠ L257), R285 (≠ Q280)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
31% identity, 93% coverage: 2:302/323 of query aligns to 5:290/310 of 6dntA
- active site: S120 (= S127), S121 (= S128), A122 (≠ S129), Y144 (= Y152), K148 (= K156), A187 (vs. gap)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A87), S120 (= S127), S121 (= S128), Y144 (= Y152), F172 (= F180), N173 (≠ T181), A187 (vs. gap), V188 (vs. gap), K191 (= K195), V203 (≠ D207), I204 (≠ L208), Y205 (= Y209), Q210 (≠ M214), R212 (= R216), I246 (≠ L257), R269 (≠ Q280), D272 (= D283)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D33 (= D31), N34 (= N32), L35 (= L33), S36 (≠ N34), S37 (= S35), G38 (≠ Y36), D57 (= D61), L58 (≠ V62), L76 (= L83), A77 (= A84), A78 (= A85), A80 (= A87), S118 (≠ A125), S119 (= S126), Y144 (= Y152), K148 (= K156), Y171 (≠ F179), V174 (= V182)
- binding zinc ion: E209 (≠ A213), H275 (≠ D286)
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
32% identity, 98% coverage: 3:318/323 of query aligns to 3:296/299 of 6kv9A
- active site: S110 (= S127), S111 (= S128), S112 (= S129), Y133 (= Y152), K137 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), R32 (≠ N32), R33 (≠ L33), D47 (= D61), L48 (≠ V62), L66 (= L83), A67 (= A84), A68 (= A85), P70 (≠ A87), C85 (≠ S102), A108 (= A125), S109 (= S126), K137 (= K156), F162 (= F179), T164 (= T181), V165 (= V182), R171 (= R188), M174 (= M191)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ A87), R73 (= R90), S110 (= S127), S111 (= S128), Y133 (= Y152), T164 (= T181), R171 (= R188), M174 (= M191), F175 (≠ A192), R178 (≠ K195), E190 (≠ D207), I191 (≠ L208), Y192 (= Y209), Q197 (≠ M214), R199 (= R216), V235 (≠ L257), D261 (= D283)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
33% identity, 98% coverage: 1:318/323 of query aligns to 1:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), T35 (≠ S35), G36 (≠ Y36), D56 (= D61), I57 (≠ V62), L77 (= L83), A78 (= A84), A79 (= A85), I81 (≠ A87), V96 (≠ S102), T119 (≠ A125), Y146 (= Y152), K150 (= K156), P173 (≠ F179), A174 (≠ F180), N175 (≠ T181), V176 (= V182)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A87), R84 (= R90), S121 (= S127), G123 (≠ S128), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), A187 (≠ P193), G188 (vs. gap), V189 (vs. gap), F193 (= F196), R204 (≠ D207), V205 (≠ L208), F206 (≠ Y209), R213 (≠ Y220), D248 (≠ L257), R271 (≠ Q280)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
33% identity, 98% coverage: 1:318/323 of query aligns to 1:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), T35 (≠ S35), G36 (≠ Y36), D56 (= D61), I57 (≠ V62), L77 (= L83), A78 (= A84), A79 (= A85), I81 (≠ A87), T119 (≠ A125), Y146 (= Y152), K150 (= K156), P173 (≠ F179), N175 (≠ T181), V176 (= V182)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A87), R84 (= R90), S121 (= S127), G123 (≠ S128), S124 (= S129), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), G188 (vs. gap), V189 (vs. gap), F193 (= F196), R204 (≠ D207), V205 (≠ L208), F206 (≠ Y209), N211 (≠ M214), R213 (≠ Y220), D248 (≠ L257), R271 (≠ Q280)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
33% identity, 98% coverage: 1:318/323 of query aligns to 1:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A87), R84 (= R90), S121 (= S127), G123 (≠ S128), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), A187 (≠ P193), G188 (vs. gap), V189 (vs. gap), F193 (= F196), R204 (≠ D207), F206 (≠ Y209), N211 (≠ M214), R213 (≠ Y220), D248 (≠ L257), R271 (≠ Q280)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), A34 (≠ N34), T35 (≠ S35), G36 (≠ Y36), D56 (= D61), I57 (≠ V62), L77 (= L83), A78 (= A84), A79 (= A85), I81 (≠ A87), T119 (≠ A125), Y146 (= Y152), K150 (= K156), P173 (≠ F179), A174 (≠ F180), V176 (= V182)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A87), R84 (= R90), S121 (= S127), G123 (≠ S128), Y146 (= Y152), A174 (≠ F180), N175 (≠ T181), A187 (≠ P193), G188 (vs. gap), V189 (vs. gap), F193 (= F196), R204 (≠ D207), F206 (≠ Y209), N211 (≠ M214), R213 (≠ Y220), D248 (≠ L257), R271 (≠ Q280)
Query Sequence
>AO356_26320 FitnessBrowser__pseudo5_N2C3_1:AO356_26320
MSVLVTGAAGFIGFHTARRLCSEGHQVIGIDNLNSYYSVELKQARLALLAEYPNFRFLRL
DVADKQALLDVFAKTPFEYVVHLAAQAGVRYSIDNPDLYAQSNLVGFLNVLEACRAHRPA
HLVFASSSSVYGLNDRLPYATTDPVDQPVSFYAATKRANELMAHAYSHLYGIPTTGLRFF
TVYGPWGRPDMAPFKFTDAILNGRAIDLYNDGAMSRDFTYIDDIVEGLVRLLPRPPANET
GVRHKLYNIGFGAPVKLLQFVECLEEALGIPAIKHFLPLQAGDVVDTWADTRELEEHIGF
RPQVAVPVGVQSFVDWYRAYYRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory