SitesBLAST
Comparing AO356_26445 FitnessBrowser__pseudo5_N2C3_1:AO356_26445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
65% identity, 98% coverage: 3:362/368 of query aligns to 1:361/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (≠ V10), G9 (= G11), G11 (= G13), V12 (= V14), V13 (= V15), E32 (= E34), A33 (= A35), T41 (= T43), S42 (= S44), R44 (= R46), N45 (= N47), S46 (= S48), V48 (= V50), H50 (= H52), P170 (= P172), L171 (= L173), A203 (= A204), I313 (= I314), R314 (= R315), I346 (= I347), E347 (= E348), S348 (= S349), P349 (= P350), G350 (= G351), L351 (= L352), T352 (= T353)
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
32% identity, 95% coverage: 18:368/368 of query aligns to 16:405/410 of 8w78A
- binding 2-oxoglutaric acid: S48 (= S48), H52 (= H52), Y245 (= Y247), F254 (≠ G254), L255 (= L255), H258 (= H258), R349 (= R315)
- binding flavin-adenine dinucleotide: E34 (= E34), K35 (≠ A35), H42 (≠ G42), Q43 (≠ T43), S44 (= S44), N47 (= N47), S48 (= S48), V50 (= V50), H52 (= H52), V173 (≠ S175), G203 (≠ A204), G204 (= G205), Q206 (≠ K207), R349 (= R315), P387 (= P350), G388 (= G351), A389 (≠ L352), T390 (= T353)
Sites not aligning to the query:
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
31% identity, 95% coverage: 18:368/368 of query aligns to 16:407/412 of 8w7fB
- binding flavin-adenine dinucleotide: E34 (= E34), K35 (≠ A35), H42 (≠ G42), Q43 (≠ T43), S44 (= S44), H46 (≠ R46), N47 (= N47), S48 (= S48), V50 (= V50), H52 (= H52), V173 (≠ L173), G205 (≠ A204), G206 (= G205), Q208 (≠ K207), Y231 (= Y233), V350 (≠ I314), R351 (= R315), P389 (= P350), G390 (= G351), A391 (≠ L352), T392 (= T353)
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
30% identity, 98% coverage: 6:367/368 of query aligns to 5:366/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), I14 (≠ V15), E33 (= E34), K34 (≠ A35), E41 (≠ G42), T42 (= T43), S43 (= S44), A45 (≠ R46), N46 (= N47), S47 (= S48), V49 (= V50), H51 (= H52), E176 (≠ A168), V177 (≠ F169), A209 (= A204), G210 (= G205), Y212 (≠ K207), Y234 (= Y233), S319 (≠ I314), R320 (= R315), M346 (≠ I347), K347 (≠ E348), S348 (= S349), P349 (= P350), G350 (= G351), L351 (= L352), T352 (= T353)
- binding sn-glycerol-3-phosphate: S47 (= S48), H51 (= H52), K258 (≠ L255), G259 (= G256), R320 (= R315), S348 (= S349)
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
30% identity, 98% coverage: 6:367/368 of query aligns to 5:366/384 of P75063
1zovA Crystal structure of monomeric sarcosine oxidase from bacillus sp. Ns- 129
25% identity, 58% coverage: 2:213/368 of query aligns to 1:211/381 of 1zovA
- active site: H45 (≠ S45), T48 (≠ S48), R49 (≠ E49), R52 (vs. gap), S98 (≠ K90)
- binding flavin-adenine dinucleotide: G10 (= G11), S13 (≠ V14), M14 (≠ V15), D33 (≠ E34), S34 (≠ A35), H39 (≠ G40), G42 (= G42), S43 (≠ T43), H44 (≠ S44), R49 (≠ E49), I50 (≠ V50), V173 (≠ L173), M201 (≠ A203), G202 (≠ A204), W204 (≠ L206)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
27% identity, 45% coverage: 20:186/368 of query aligns to 20:177/374 of 1y56B
- active site: F44 (≠ S45), G47 (≠ S48), T48 (≠ E49)
- binding flavin-adenine dinucleotide: I33 (= I33), E34 (= E34), K35 (≠ A35), S42 (≠ T43), T43 (≠ S44), R45 (= R46), C46 (≠ N47), G47 (≠ S48), G49 (≠ V50), E170 (≠ P172), V171 (≠ L173)
- binding flavin mononucleotide: F44 (≠ S45), R45 (= R46)
Sites not aligning to the query:
- active site: 224, 239, 305, 338
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 200, 201, 203, 305, 306, 307, 334, 335, 336, 337, 338
- binding flavin mononucleotide: 260, 301, 303
Query Sequence
>AO356_26445 FitnessBrowser__pseudo5_N2C3_1:AO356_26445
VSVDIDCVVVGAGVVGLAVAREMALAGHEVLVIEAGEAIGIGTSSRNSEVIHAGIYYPPG
SLKAQLCVEGRHALYAYCDSHGVSTRKTGKLIVAKDEAQVRQLQVLLERGLVNGVEDLRL
LDREQALALEPALECIAALYSPSTGIVDSHGLMLALQGDAEAAGTTIAFYSPLISARVTA
DGFLLDVGGAAPMVLSCRLLINAAGLKAPALARRMEGLAQQTVPRDYLCKGSYFSLAKRA
PFTHLIYPAPEAAGLGVHMTLDLGGQARFGPDTEWVEAEDYRVDPSRANAFYAAIRSYWP
DLPDNSLQPGYSGIRPKISAPGEPASDFLISSERLHNVPGLINLFGIESPGLTACLAIAK
RVRGLLER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory